KEGG   Homo sapiens (human): 139285Help
Entry
139285            CDS       T01001                                 

Gene name
AMER1, FAM123B, OSCS, WTX
Definition
(RefSeq) APC membrane recruitment protein 1
  KO
K19407  APC membrane recruitment protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00444  Osteopathia striata with cranial sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    139285 (AMER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WTX
Motif
Other DBs
NCBI-GeneID: 139285
NCBI-ProteinID: NP_689637
OMIM: 300647
HGNC: 26837
Ensembl: ENSG00000184675
Vega: OTTHUMG00000021703
Pharos: Q5JTC6(Tbio)
UniProt: Q5JTC6
Position
Xq11.2
AA seq 1135 aa AA seqDB search
METQKDEAAQAKGAAASGSTREQTAEKGAKNKAAEATEGPTSEPSSSGPGRLKKTAMKLF
GGKKGICTLPSFFGGGRSKGSGKGSSKKGLSKSKTHDGLSEAAHGPEDVVSEGTGFSLPL
PELPCQFPSSQSAHGALETGSRCKTSVAGATEKAVAEKFPSMPKPKKGLKGFFSSIRRHR
KSKVTGAEQSEPGAKGPERVRARPHEHVSSAPQVPCFEETFQAPRKENANPQDAPGPKVS
PTPEPSPPATEKMACKDPEKPMEACASAHVQPKPAPEASSLEEPHSPETGEKVVAGEVNP
PNGPVGDPLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMTDSMASGGQRANRDGTKRSS
CLVTYQGGGEEMALPDDDDEEEEEEEEVELEEEEEEVKEEEEDDDLEYLWETAQMYPRPN
MNLGYHPTTSPGHHGYMLLDPVRSYPGLAPGELLTPQSDQQESAPNSDEGYYDSTTPGFE
DDSGEALGLVRRDCLPRDSYSGDALYEFYEPDDSLENSPPGDDCLYDLHGRSSEMFDPFL
NFEPFLSSRPPGAMETEEERLVTIQKQLLYWELRREQLEAQEARAREAHAREAHAREAYT
REAYGREAYAREAHTWEAHGREARTREAQAREVRCRETQVRETQARQEKPVLEYQMRPLG
PSVMGLAAGVSGTSQISHRGITSAFPTTASSEPDWRDFRPLEKRYEGTCSKKDQSTCLMQ
LFQSDAMFEPDMQEANFGGSPRRAYPTYSPPEDPEEEEVEKEGNATVSFSQALVEFTSNG
NLFSSMSCSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFHNDEDLAASLEA
FELGYYHKHAFNNYHSRFYQGLPWGVSSLPRYLGLPGLHPRPPPAAMALNRRSRSLDTAE
TLEMELSNSHLVQGYLESDELQAQQEDSDEEDEEEEEGEWSRDSPLSLYTEPPGAYDWPA
WAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQL
ARPSHLHLPMGPCYNLQPQASQSMRARPRDVLLPVDEPSCSSSSGGFSPSPLPQAKPVGI
THGIPQLPRVRPEHPQPQPTHYGPSSLDLSKERAEQGASLATSYSSTAMNGNLAK
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggagacccaaaaggatgaagctgctcaggccaagggagctgcagcctctgggagtacc
cgtgaacaaacagcagaaaaaggagccaagaacaaggcagctgaggcgacagaaggacca
acctcagagccatcctcatccggcccaggtaggctgaagaaaactgccatgaaactcttt
ggtggcaagaagggtatctgtactctgcctagtttctttggagggggacggagcaaaggt
tctgggaaaggcagctccaagaaaggtctcagcaagagcaagacccacgatggcctgagt
gaagcagcccatggccctgaagatgttgtcagtgaaggaactggcttctccctgcctttg
cctgagttaccctgccaatttcccagctctcagagtgcccatggggctttggagacaggc
tccagatgtaagacatctgtggctggagccacagagaaagctgtggctgagaagtttccc
tctatgcccaagccaaagaaaggcctaaaaggcttttttagcagtatccgccgtcaccgg
aagagcaaggtcactggggctgagcaaagtgagccaggggccaaggggcctgagagggtc
agagccaggcctcatgagcacgtgagctcagcccctcaggtgccctgctttgaggagacc
ttccaagcccctagaaaggaaaatgctaacccccaagatgcccctgggccaaaagtttct
ccaacaccagaaccttctccaccagctactgagaaaatggcctgtaaagatccagaaaaa
cccatggaggcctgtgcctcagcacatgtgcaacccaagcctgcccctgaagccagtagc
ctagaggagccccatagcccagaaacaggggagaaggtagtagcaggagaggtaaaccca
cccaatggccctgtgggggacccactgagcctcttgtttggggatgtgacatccctgaaa
agctttgattcattgacaggttgtggtgacataatagcagaacaggacatggacagtatg
acagacagcatggcctctgggggccagagagcaaaccgagatgggaccaagcgaagttcc
tgcctggtgacctaccaaggaggtggggaggagatggccttgccagatgatgatgacgag
gaggaagaagaggaagaagaggtggaattagaggaggaagaagaggaggttaaggaggag
gaagaagatgatgacttagaatatctgtgggaaactgcccaaatgtatccacggcccaat
atgaacctgggctaccatcccaccacatccccaggccaccacggctacatgctccttgac
ccagttaggtcttatcctggcctagcccctggggaacttttgactcctcagagtgaccag
caagaatccgcccccaatagtgatgaaggttattatgactccaccacacctggatttgag
gatgattcaggtgaggccctggggcttgtccgcagggattgtctaccccgagacagctac
agtggagatgccctatatgagttctatgagccagatgacagccttgagaactctccacct
ggagatgactgcctttatgacctccatggtcgaagctctgagatgtttgaccccttctta
aactttgagccctttttgtcctcccggccacctggggcaatggagacagaggaagaacgg
ctagtgaccatccagaaacagttgttgtattgggagcttcggcgggagcagcttgaggcc
caggaggcacgtgcccgagaagctcatgccagggaggcccacgccagggaggcctatact
cgagaggcttatggcagggaagcctatgccagggaggcccacacttgggaagctcatggc
agggaggccagaacccgagaagcccaggcccgagaggttcgttgtagagagactcaagtc
cgagagacccaggcccggcaggagaagcccgtcttagagtatcagatgaggcccttaggc
ccatcagtgatgggcctggcagcaggggtatcagggacctctcagatttcccaccgggga
attacctcagctttccccaccactgcaagcagcgagccagactggagggacttccgtcct
ctggagaagcgttatgaaggaacctgctccaagaaagatcaaagtacctgcctgatgcag
ctcttccagagtgatgccatgtttgagccagacatgcaagaagcaaattttggaggatct
cccaggagggcctaccctacttattcaccccctgaagatccagaggaagaggaggttgag
aaggaagggaatgccactgtgagtttctcacaggccctggtagagttcaccagcaatggg
aacctcttttccagcatgtcctgcagctctgactctgactcatctttcactcaaaacctc
cctgagctgcctcccatggtgacctttgacatcgctgatgtggaacgggatggggaaggc
aagtgtgaagagaatcctgagttccacaatgatgaagatcttgcagcctccttggaagcc
tttgagctgggctactatcacaaacatgccttcaacaactaccatagtcgattctaccaa
ggcctgccctggggtgtgagcagcctccctcgatacttgggactgcctggcctgcaccct
cgacctccacctgctgctatggccctcaacaggagaagccgctctctcgacactgcagag
accctggagatggagctctccaattcccacttggtccagggctacctcgagtctgatgag
ctgcaggcccagcaggaagattcagatgaggaggacgaagaggaggaagaaggagaatgg
agccgagacagtcccctttccctctatactgaacccccaggggcctatgattggcctgct
tgggctccctgtcctcttccagtggggccaggtcctgcctggataagccccaaccagttg
gacaggccttccagccagtctccatataggcaggcaacctgttgcatacctcctatgacc
atgtcaatatcactatcagtgccagagtcaagggcacctggggaatctgggcctcaacta
gctcgtccctcacacctacacctgcccatgggcccttgctataacctccagccacaggcc
tcccagagcatgagggccaggcctcgagatgtgctgctgcctgttgatgagcccagttgc
tcttccagttctggaggcttcagccccagccctctaccacaggccaagcctgtgggcatc
acccatggcattcctcagctgcccagggtccggcctgagcacccccagcctcagcccact
cactatgggccttccagccttgacctgtcaaaggagagggctgagcaaggtgcctctctt
gccaccagctactcctccactgccatgaatggaaacctagccaagtag

DBGET integrated database retrieval system