KEGG   Homo sapiens (human): 1393
Entry
1393              CDS       T01001                                 

Symbol
CRHBP, CRF-BP, CRFBP
Name
(RefSeq) corticotropin releasing hormone binding protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CRF-BP
Other DBs
NCBI-GeneID: 1393
NCBI-ProteinID: NP_001873
OMIM: 122559
HGNC: 2356
Ensembl: ENSG00000145708
Vega: OTTHUMG00000102133
Pharos: P24387(Tbio)
UniProt: P24387
Position
5q13.3
AA seq 322 aa
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtcgcccaacttcaaacttcagtgtcacttcattctcatcttcctgacggctctaaga
ggggaaagccggtacctagagctgagggaagcggcggactacgatcctttcctgctcttc
agcgccaacctgaagcgggagctggctggggagcagccgtaccgccgcgctctgcggtgc
ctggacatgctgagcctccagggccagttcaccttcaccgccgaccggccgcagctgcac
tgcgcagccttcttcatcagcgagcccgaggagttcattaccatccactacgaccaggtc
tccatcgactgtcagggcggcgacttcctgaaggtatttgatggttggattctcaagggg
gagaagttccccagttcccaggatcatcctctcccctcagctgagcggtacatagatttc
tgtgagagtggtcttagcaggaggagcatcagatcttcccagaatgtggccatgatcttc
ttccgagtccatgaaccaggaaatggattcacattaaccataaagacagaccccaacctc
tttccttgcaatgtcatttctcagactccaaatggaaagtttaccctggtagttccacac
cagcatcgaaactgcagcttctccataatttatcctgtggtgatcaaaatatctgatctt
accctgggacacgtaaatggtcttcagttaaagaaatcctcagcaggttgcgagggaata
ggagactttgtggagctgctgggaggaactggattggacccttccaagatgacgccttta
gctgatctctgctacccctttcatggcccggcccagatgaaagttggctgtgacaacact
gtggtgcgcatggtctccagtggaaaacacgtaaatcgtgtgacttttgagtatcgtcag
ctggagccgtacgagctggaaaacccaaatggaaacagtatcggggaattctgtttgtct
ggtctttga

DBGET integrated database retrieval system