KEGG   Homo sapiens (human): 1393
Entry
1393              CDS       T01001                                 
Symbol
CRHBP, CRF-BP, CRFBP
Name
(RefSeq) corticotropin releasing hormone binding protein
  KO
K25477  corticotropin-releasing factor-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    1393 (CRHBP)
SSDB
Motif
Pfam: CRF-BP
Other DBs
NCBI-GeneID: 1393
NCBI-ProteinID: NP_001873
OMIM: 122559
HGNC: 2356
Ensembl: ENSG00000145708
Pharos: P24387(Tbio)
UniProt: P24387
Position
5:76953045..76981159
AA seq 322 aa
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtcgcccaacttcaaacttcagtgtcacttcattctcatcttcctgacggctctaaga
ggggaaagccggtacctagagctgagggaagcggcggactacgatcctttcctgctcttc
agcgccaacctgaagcgggagctggctggggagcagccgtaccgccgcgctctgcggtgc
ctggacatgctgagcctccagggccagttcaccttcaccgccgaccggccgcagctgcac
tgcgcagccttcttcatcagcgagcccgaggagttcattaccatccactacgaccaggtc
tccatcgactgtcagggcggcgacttcctgaaggtatttgatggttggattctcaagggg
gagaagttccccagttcccaggatcatcctctcccctcagctgagcggtacatagatttc
tgtgagagtggtcttagcaggaggagcatcagatcttcccagaatgtggccatgatcttc
ttccgagtccatgaaccaggaaatggattcacattaaccataaagacagaccccaacctc
tttccttgcaatgtcatttctcagactccaaatggaaagtttaccctggtagttccacac
cagcatcgaaactgcagcttctccataatttatcctgtggtgatcaaaatatctgatctt
accctgggacacgtaaatggtcttcagttaaagaaatcctcagcaggttgcgagggaata
ggagactttgtggagctgctgggaggaactggattggacccttccaagatgacgccttta
gctgatctctgctacccctttcatggcccggcccagatgaaagttggctgtgacaacact
gtggtgcgcatggtctccagtggaaaacacgtaaatcgtgtgacttttgagtatcgtcag
ctggagccgtacgagctggaaaacccaaatggaaacagtatcggggaattctgtttgtct
ggtctttga

DBGET integrated database retrieval system