KEGG   Homo sapiens (human): 139341
Entry
139341            CDS       T01001                                 

Gene name
FUNDC1
Definition
(RefSeq) FUN14 domain containing 1
  KO
K17986  FUN14 domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    139341 (FUNDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    139341 (FUNDC1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    139341 (FUNDC1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    139341 (FUNDC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    139341 (FUNDC1)
SSDB
Motif
Pfam: FUN14 EutA ApoO
Other DBs
NCBI-GeneID: 139341
NCBI-ProteinID: NP_776155
OMIM: 300871
HGNC: 28746
Ensembl: ENSG00000069509
Vega: OTTHUMG00000021399
Pharos: Q8IVP5(Tdark)
UniProt: Q8IVP5
Position
Xp11.3
AA seq 155 aa
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVT
GWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA
APEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcgacccggaacccccctccccaagactatgaaagtgatgacgactcttatgaagtg
ttggatttaactgagtatgcaagaagacaccagtggtggaatcgagtgtttggccacagt
tcgggacctatggtagaaaaatactcagtagctacccagattgtaatgggtggcgttact
ggctggtgtgcaggatttctgttccagaaagttggaaaacttgcagcaactgcagtaggt
ggtggctttcttcttcttcagattgctagtcatagtggctatgtgcagattgactggaag
agagttgaaaaagatgtaaataaagcaaaaagacagattaagaaacgagcgaacaaagca
gcacctgaaatcaacaatttaattgaagaagcaacagaatttatcaagcagaacattgtg
atatccagtggatttgtgggaggctttttgctcggacttgcatcttaa

DBGET integrated database retrieval system