KEGG   Homo sapiens (human): 1394Help
Entry
1394              CDS       T01001                                 

Gene name
CRHR1, CRF-R, CRF-R-1, CRF-R1, CRF1, CRFR-1, CRFR1, CRH-R-1, CRH-R1, CRHR, CRHR1L
Definition
(RefSeq) corticotropin releasing hormone receptor 1
  KO
K04578  corticotropin releasing hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04730  Long-term depression
hsa04934  Cushing syndrome
Network
N00324  CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Drug target
Corticorelin (DG01167): D03591 D03592 D03905
Emicerfont: D09610
Pexacerfont: D10022
Verucerfont: D09695
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1394 (CRHR1)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    1394 (CRHR1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1394 (CRHR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1394 (CRHR1)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone
    1394 (CRHR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Tissue_fac
Motif
Other DBs
NCBI-GeneID: 1394
NCBI-ProteinID: NP_001138618
OMIM: 122561
HGNC: 2357
Ensembl: ENSG00000120088
Vega: OTTHUMG00000178271
Pharos: P34998(Tclin)
UniProt: P34998
Structure
PDB: 

Position
17q21.31
AA seq 444 aa AA seqDB search
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcacccgcagctccgtctcgtcaaggcccttctccttctggggctgaacccc
gtctctgcctccctccaggaccagcactgcgagagcctgtccctggccagcaacatctca
ggactgcagtgcaacgcatccgtggacctcattggcacctgctggccccgcagccctgcg
gggcagctagtggttcggccctgccctgcctttttctatggtgtccgctacaataccaca
aacaatggctaccgggagtgcctggccaatggcagctgggccgcccgcgtgaattactcc
gagtgccaggagatcctcaatgaggagaaaaaaagcaaggtgcactaccatgtcgcagtc
atcatcaactacctgggccactgtatctccctggtggccctcctggtggcctttgtcctc
tttctgcggctcaggccaggctgcacccattggggtgaccaggcagatggagccctggag
gtgggggctccatggagtggtgccccatttcaggttcgaaggagcatccggtgcctgcga
aacatcatccactggaacctcatctccgccttcatcctgcgcaacgccacctggttcgtg
gtccagctaaccatgagccccgaggtccaccagagcaacgtgggctggtgcaggttggtg
acagccgcctacaactacttccatgtgaccaacttcttctggatgttcggcgagggctgc
tacctgcacacagccatcgtgctcacctactccactgaccggctgcgcaaatggatgttc
atctgcattggctggggtgtgcccttccccatcattgtggcctgggccattgggaagctg
tactacgacaatgagaagtgctggtttggcaaaaggcctggggtgtacaccgactacatc
taccagggccccatgatcctggtcctgctgatcaatttcatcttccttttcaacatcgtc
cgcatcctcatgaccaagctccgggcatccaccacgtctgagaccattcagtacaggaag
gctgtgaaagccactctggtgctgctgcccctcctgggcatcacctacatgctgttcttc
gtcaatcccggggaggatgaggtctcccgggtcgtcttcatctacttcaactccttcctg
gaatccttccagggcttctttgtgtctgtgttctactgtttcctcaatagtgaggtccgt
tctgccatccggaagaggtggcaccggtggcaggacaagcactcgatccgtgcccgagtg
gcccgtgccatgtccatccccacctccccaacccgtgtcagctttcacagcatcaagcag
tccacagcagtctga

DBGET integrated database retrieval system