KEGG   Homo sapiens (human): 139425
Entry
139425            CDS       T01001                                 

Gene name
DCAF8L1, WDR42B
Definition
(RefSeq) DDB1 and CUL4 associated factor 8 like 1
  KO
K11804  DDB1- and CUL4-associated factor 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    139425 (DCAF8L1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     139425 (DCAF8L1)
SSDB
Motif
Pfam: WD40 CRT10
Other DBs
NCBI-GeneID: 139425
NCBI-ProteinID: NP_001017930
HGNC: 31810
Ensembl: ENSG00000226372
Vega: OTTHUMG00000021312
Pharos: A6NGE4(Tdark)
UniProt: A6NGE4
Position
Xp21.3
AA seq 600 aa
MSHQEGSTGGLPDLVTESLFSSPEEQSGVAAVTAASSDIEMAATEPSTGDGGDTRDGGFL
NDASTENQNTDSESSSEDVELESMGEGLFGYPLVGEETEREEEEEEMEEEGEEEEQPRMC
PRCGGTNHDQCLLDEDQALEEWISSETSALPRSRWQVLTALRQRQLGSSARFVYEACGAR
TFVQRFRLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFESGHDI
NVIQAKFFPNCGDSTLAMCGHDGQVRVAELINASYCENTKRVAKHRGPAHELALEPDSPY
KFLTSGEDAVVFTIDLRQDRPASKVVVTRENDKKVGLYTISMNPANIYQFAVGGHDQFVR
IYDQRRIDKKENNGVLKKFTPHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSS
LSDGAQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDR
GDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKTATELTGLKDVIKKNKQERDEDNLNYT
DSFDNRMLRFFVRHLLQRAHQPGWRDHGAEFPDEEELDESSSTSDTSEEEGQDRVQCIPS
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtcccaccaagagggcagcacaggtggcttaccagacttagtgactgaaagcctgttc
agcagcccagaggagcagtctggagtagcagcggtgacggcggcctcctcagacattgaa
atggcagccacagagccatcgaccggagatggtggtgataccagggatggtggtttcctg
aacgatgccagcacagaaaatcaaaacacagactcagaaagttcaagtgaagacgtcgaa
cttgaaagcatgggtgaaggtttatttggttacccgttagtgggagaggagacagaaagg
gaggaggaagaagaagagatggaggaggaaggggaggaggaagaacagcctcggatgtgt
ccacgatgcggtggcaccaaccatgatcagtgtttgttagacgaggatcaggcgttggag
gagtggatttcctcagagacatctgccctgccccgatctcgctggcaagtccttactgct
cttcgccagcggcagctgggttcaagtgcccgctttgtatatgaggcctgtggggcaaga
acctttgtgcagcgtttccgcctgcagtatcttcttggaagccatgccggttctgtcagt
accatacactttaaccagcgtggcacccgactggccagtagcggtgatgacttaagggtg
atagtgtgggactgggtgcggcagaagccagtactgaactttgagagtggtcacgatatt
aatgtcatccaggctaagttctttcctaactgtggtgattccactctggccatgtgtggc
catgatggacaggtacgggtagcagaactaattaatgcatcatattgcgagaatactaag
cgtgtggccaagcacaggggacctgcccacgagttggctctggagccagactctccttat
aagttcctcacttcaggtgaagatgccgttgtgttcaccattgacctcaggcaagaccgg
ccagcttcaaaagttgtggtaacaagagaaaatgataagaaagtcggactgtatacaatc
tctatgaatcctgccaatatttaccaatttgcagtgggtggacatgatcagtttgtaagg
atttatgaccagaggagaattgataagaaagaaaacaatggagtactcaagaaattcact
cctcatcatctggtttattgtgatttcccaacaaacatcacctgcgttgtgtacagccac
gatggcacagagctcctggccagctacaatgatgaagatatttacctcttcaactcctct
ctcagtgatggtgctcaatatgttaagagatataaggggcacagaaataatgacacaatc
aaatgtgttaatttctatggcccccggagtgagtttgtcgtgagcggtagtgattgtggg
cacgtcttcttctgggagaaatcatcctcccagatcatccagttcatggagggggacaga
ggagatatagtaaactgtcttgaaccccacccttacctacctgtgttggcgaccagtggc
ctagatcagcatgtcaggatctggacacccacagctaaaactgccactgagcttactggg
ttaaaagatgtgattaagaagaacaagcaggagcgagatgaagacaacttgaactatacg
gactcgtttgacaaccgcatgcttcggttcttcgtgcgtcacctgttacagagagctcat
caacccggctggagagatcatggagctgagttcccagatgaagaagagttggatgagtct
tccagcacctcagatacatccgaggaggagggccaagatcgagtgcagtgcataccatcc
tga

DBGET integrated database retrieval system