KEGG   Homo sapiens (human): 1395Help
Entry
1395              CDS       T01001                                 

Gene name
CRHR2, CRF-RB, CRF2, CRFR2, HM-CRF
Definition
(RefSeq) corticotropin releasing hormone receptor 2
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04934  Cushing syndrome
Network
N00324  CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Drug target
Corticorelin (DG01167): D03591 D03592 D03905
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1395 (CRHR2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1395 (CRHR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1395 (CRHR2)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone
    1395 (CRHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 1395
NCBI-ProteinID: NP_001874
OMIM: 602034
HGNC: 2358
Ensembl: ENSG00000106113
Vega: OTTHUMG00000023218
Pharos: Q13324(Tbio)
UniProt: Q13324 A0A090N7T4
Structure
PDB: 

Position
7p14.3
AA seq 411 aa AA seqDB search
MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggcactgctccacagcctgctggaggccaactgcagcctggcgctggctgaa
gagctgctcttggacggctgggggccacccctggaccccgagggtccctactcctactgc
aacacgaccttggaccagatcggaacgtgctggccccgcagcgctgccggagccctcgtg
gagaggccgtgccccgagtacttcaacggcgtcaagtacaacacgacccggaatgcctat
cgagaatgcttggagaatgggacgtgggcctcaaagatcaactactcacagtgtgagccc
attttggatgacaagcagaggaagtatgacctgcactaccgcatcgcccttgtcgtcaac
tacctgggccactgcgtatctgtggcagccctggtggccgccttcctgcttttcctggcc
ctgcggagcattcgctgtctgcggaatgtgattcactggaacctcatcaccacctttatc
ctgcgaaatgtcatgtggttcctgctgcagctcgttgaccatgaagtgcacgagagcaat
gaggtctggtgccgctgcatcaccaccatcttcaactacttcgtggtgaccaacttcttc
tggatgtttgtggaaggctgctacctgcacacggccattgtcatgacctactccactgag
cgcctgcgcaagtgcctcttcctcttcatcggatggtgcatccccttccccatcatcgtc
gcctgggccatcggcaagctctactatgagaatgaacagtgctggtttggcaaggagcct
ggcgacctggtggactacatctaccaaggccccatcattctcgtgctcctgatcaatttc
gtatttctgttcaacatcgtcaggatcctaatgacaaagttacgcgcgtccaccacatcc
gagacaatccagtacaggaaggcagtgaaggccaccctggtgctcctgcccctcctgggc
atcacctacatgctcttcttcgtcaatcccggggaggacgacctgtcacagatcatgttc
atctatttcaactccttcctgcagtcgttccagggtttcttcgtgtctgtcttctactgc
ttcttcaatggagaggtgcgctcagccgtgaggaagaggtggcaccgctggcaggaccat
cactcccttcgagtccccatggcccgggccatgtccatccctacatcacccacacggatc
agcttccacagcatcaagcagacggccgctgtgtga

DBGET integrated database retrieval system