KEGG   Homo sapiens (human): 139596Help
Entry
139596            CDS       T01001                                 

Gene name
UPRT, FUR1, UPP
Definition
(RefSeq) uracil phosphoribosyltransferase homolog
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    139596 (UPRT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     139596 (UPRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPRTase Pribosyltran
Motif
Other DBs
NCBI-GeneID: 139596
NCBI-ProteinID: NP_659489
OMIM: 300656
HGNC: 28334
Ensembl: ENSG00000094841
Vega: OTTHUMG00000021864
Pharos: Q96BW1(Tbio)
UniProt: Q96BW1 A8KAF9
Position
Xq13.3
AA seq 309 aa AA seqDB search
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSL
PAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIR
ELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNC
GVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPI
LSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTH
FGQKYFGTD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccacggagttacagtgtccggactccatgccctgtcacaaccagcaagtaaactct
gcctcaaccccaagtcccgagcagctgcgacctggcgatctgatcctggaccacgcaggg
ggaaacagagcctccagggccaaggtgattctcctcacggggtacgcccattctagcctg
ccggccgagctggactctggggcctgcggcggctccagcctcaactcagagggcaacagt
ggtagtggtgacagtagcagctatgacgcaccagctggcaactccttcctagaggactgc
gaactctcccggcagatcggggcgcagcttaagctgctgcctatgaatgatcagatacgg
gagctacagaccatcatccgtgacaagacagccagtagaggtgacttcatgttttctgcg
gatcgtttgatcagacttgttgtggaagagggattgaatcagctgccatataaagaatgc
atggtgaccactccaacagggtacaagtatgaaggagtgaaatttgagaagggaaattgt
ggggtcagcataatgagaagcggtgaggcaatggaacaaggtttacgagactgctgtcga
tccatacgaattggaaagatcctgattcagagtgatgaggagacacaaagagccaaagta
tattatgccaaattccccccagacatttaccggagaaaagtccttctgatgtatccaatt
ctcagcactggaaatactgtaattgaagctgtaaaggttcttatagaacatggagttcaa
cccagtgttatcatcctactcagtctgttctccactcctcatggtgccaaatcaatcatt
caggagtttccagagatcacaattttaactactgaagttcatcctgttgcacctacacat
tttggacagaaatactttggaacagactaa

DBGET integrated database retrieval system