KEGG   Homo sapiens (human): 1397
Entry
1397              CDS       T01001                                 
Symbol
CRIP2, CRIP, CRP2, ESP1
Name
(RefSeq) cysteine rich protein 2
  KO
K24413  cysteine-rich protein 2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    1397 (CRIP2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  CRP family proteins
   1397 (CRIP2)
SSDB
Motif
Pfam: LIM NinD zf_UBZ zf-ACC
Other DBs
NCBI-GeneID: 1397
NCBI-ProteinID: NP_001303
OMIM: 601183
HGNC: 2361
Ensembl: ENSG00000182809
Pharos: P52943(Tbio)
UniProt: P52943
Structure
Position
14:105472945..105480170
AA seq 208 aa
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYAT
LFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFT
GEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG
ILFGPKGVNTGAVGSYIYDRDPEGKVQP
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcctccaaatgccccaagtgcgacaagaccgtgtacttcgccgagaaggtgagctcc
ctggggaaggactggcacaagttctgcctcaagtgcgagcgctgcagcaagacgctgacg
cccgggggccacgccgagcatgacgggaagccgttctgccacaagccgtgctacgccacc
ctgttcggacccaaaggcgtgaacatcgggggcgcgggctcctacatctacgagaagccc
ctggcggaggggccgcaggtcaccggccccatcgaggtccccgcggcccgagcagaggag
cggaaggcgagcggccccccgaaggggcccagcagagcctccagtgtcaccactttcacc
ggggagcccaacacgtgcccgcgctgcagcaagaaggtgtacttcgctgagaaggtgacg
tctctgggcaaggattggcaccggccctgcctgcgctgcgagcgctgcgggaagacactg
acccccggcgggcacgcggagcacgacggccagccctactgccacaagccctgctatgga
atcctcttcggacccaagggagtgaacaccggtgcggtgggcagctacatctatgaccgg
gaccccgaaggcaaggtccagccctag

DBGET integrated database retrieval system