KEGG   Homo sapiens (human): 139804Help
Entry
139804            CDS       T01001                                 

Gene name
RBMXL3, CXorf55
Definition
(RefSeq) RBMX like 3
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    139804 (RBMXL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    139804 (RBMXL3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    139804 (RBMXL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM
Motif
Other DBs
NCBI-GeneID: 139804
NCBI-ProteinID: NP_001138818
HGNC: 26859
Ensembl: ENSG00000175718
Vega: OTTHUMG00000022230
Pharos: Q8N7X1(Tdark)
UniProt: Q8N7X1
Position
Xq23
AA seq 1067 aa AA seqDB search
MMEADRPEKLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPA
DAKAAARDMNGKYLDGKAIMVAQTIKPAFKSSRWVPPTPGSGSRSRFSHRTRGGGSSPQR
PPSQGRPDDGRGYAGYFDLWPYRAPMPRKRGPPPRHWASPPHKRATPSSLAHSVGCGMRG
KAPTVSGQDGYSGLQPRRWAGPPHKRAVPRSSLARIGGSGMPGKAPAVWGQDGYSGPRVR
EPLPPCRDPGDFVPALRDYSRRYYGHSSVPDYRPLRGDGNQNGYRGRDHEYTDHPSKGSY
REPLKSYGGPCGAAPVWGTPPSYGGGCRYEEYQGNSPDACSEGRSSEALPVVLPDAYSRD
HSPKAYSGGRSSSSNGYSRSDRYGEEGCYEEYRGRSPDAHSGGRNSSSNSYGQSHHYGGE
GRYEEYRGRSHEARSGGRSTDAHSRGRSDDAYSGGHDSSSWSDCCGGGGRYEEYQGRSLD
ANSGGCSPEAYSGGHDNSSWSDRYGVGGHYEENRGHSLDANSGGRSPDTHSGGHSSSSNS
YGQSHRYGGEGRYEYRGRSHDAHSGGCSADAYSGGHDSSSQSNRYGGGGCYEEYRGRSLD
ANSGGRSPNAYSGGHDSSSWSHRYGGGGRYEEYRGRSLDANSGGRSPDAYSGGHDSSGQS
NCYGGGGRYEEYRGRLLDANSGGRSPDAYSGGHDSSSQSNRYGGGGRYEEYRGHSLDANS
GGRSPDTYSRGHDSSSQSDHYGGGGRSLDANSSGRLPDAYSGGHDSSSRSHRYGGGGRYE
EYRGRSLDANSGGRSPNAYSGGHNSSSRNDPCRGGGRYEENRGHSLDANSGGHSPNAYSG
GRDSSSNSYDRSHRYGGGGHYEEYRGRSHDTHSRGRSPDAHSGDHYTEAYSRGRDSFSNS
YGRSDHYGRGGCYEEYQGRSPNAYGGGRGLNSSNNSHGRSHRYGGGGRYEEYRGPSPDAH
SGGRDSSIKSYGLSDRYGGGGHYEEYQGSLPDAYSGDHDRSSNSYGRSDRYSRGRDRVGR
PDRGLPLPMETGSPPLHDSYSRSGCRVPRGGGRQGGRFERGEGRSRY
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagcggatcgcccagagaagcttttcattgggggcctcaacctcaaaaccgac
gagaaagccctcaaagccgagtttggcaagtatggccacatcatcaaggtgttcctgatg
aaagaccgaaaaaccaacaagtcgaggggcttcgcgttcgtcaccttcgaaagccctgca
gacgccaaggctgccgccagagatatgaacggcaagtacctggatggtaaggccatcatg
gtggcccagaccatcaaaccggcattcaagagcagccgatgggtcccgccaacccccggc
agcggcagtcgctcaaggttctcacacagaacccgtgggggtggcagcagcccacagcga
cccccctctcagggcaggcctgatgacggccgcggctacgcggggtatttcgacctgtgg
ccctacagggccccgatgcccaggaagcgcgggccgccaccgcggcactgggccagccca
ccccacaagagggccacgccgtcgagcctggctcacagcgttggctgtggaatgcgcggg
aaggcaccgactgtgtcggggcaagatggctactcaggcttgcagccacggcgctgggcc
ggcccaccccacaagagggctgtgccccggtcaagcctggctcgcattggcggcagtgga
atgcctgggaaggccccggccgtgtgggggcaagatggctactcaggcccgcgggtccgg
gagccactgcccccgtgccgcgaccctggggattttgtccctgcgctcagagactacagc
cgccgctattatggccactccagtgtcccggactaccgtcccttgagaggcgacggcaac
caaaatggctacaggggtcgcgaccatgagtacacagatcatcccagcaaaggctcctac
cgagagcccctcaagagctacggaggcccatgcggcgctgcccctgtgtgggggacaccg
ccatcttatggaggaggatgccgctacgaggagtaccagggcaactcgcccgatgcctgc
agtgaaggccgctcgtccgaggccttgccagtcgtcttgccagacgcctacagcagggac
cactcgcccaaagcctatagtgggggccgcagcagttccagtaacggttacagccggagt
gaccgctacggagaagaaggctgctacgaggagtacagaggccgctcgcccgacgcccac
agcgggggccgcaacagttccagcaacagttacggccagagccaccactatggaggagaa
ggccgctatgaggagtaccgaggccgctcacacgaggcccgcagcgggggccgctccact
gatgcccacagcaggggccggtccgacgacgcctacagtgggggccatgacagttccagc
tggagcgactgctgcggaggaggaggccgttatgaggagtaccaaggccgctcgctggat
gccaacagtggaggctgctcgcccgaggcctacagtgggggccacgacaattccagctgg
agcgaccgctacggagtaggaggccactatgaggagaaccgaggccactctctggatgcc
aacagcggaggccgttcacccgacacccacagtgggggccacagcagttccagcaacagt
tacggccagagccaccgctatggaggagaaggccgctatgagtaccgaggccgctcgcat
gacgcccacagtgggggctgctctgccgacgcctacagtgggggccacgacagttccagc
cagagcaaccgctacggaggaggaggctgctacgaggagtaccgaggccgctccctcgat
gccaacagtggaggccgctcgcccaatgcctacagcgggggccacgacagttccagctgg
agccaccgctacggaggaggaggccgctacgaggagtaccgaggccgctcccttgatgcc
aacagtggaggccgctcgcctgatgcctacagtgggggccacgacagttctggccagagc
aactgctacggaggaggaggccgctacgaggagtaccgaggccgcttgctcgatgccaac
agtggaggccgctcgcctgatgcctacagtgggggccacgacagttccagccagagcaac
cgctatggaggaggcggccgctacgaggagtaccgaggccactcgcttgatgccaacagc
ggaggccgctcgcctgacacctacagccggggccacgacagttccagccagagcgaccac
tatggaggaggaggtcgctcactcgatgccaacagcagtggccgcttgcctgacgcctac
agtgggggccatgacagttccagccggagccaccgctacggaggaggaggccgctacgag
gagtaccgaggccgctcgctcgatgccaacagcggaggccgctcacccaatgcctacagc
gggggccacaacagttccagccggaacgacccctgcagaggaggaggccgctacgaggag
aaccgaggtcactctctcgatgccaacagcggaggccactcacccaacgcctacagtggg
ggccgtgacagttccagcaacagttacgaccggagccaccgctatggaggaggaggccac
tacgaagagtaccgaggccgctcgcacgacacccacagcaggggccgatcgcccgatgcc
cacagcggggaccactacaccgaagcctacagcaggggccgcgacagtttcagcaacagc
tatggccggagtgaccattacggaagaggaggctgctacgaggaataccaaggccgctcg
cccaatgcctacggcgggggccgcggcctcaacagttccaacaacagtcatggccggagc
caccgctacggaggaggaggccgctacgaggagtaccgaggcccctcgcctgacgcccac
agtgggggccgcgacagttccatcaagagttacggcctgagcgaccgctacggaggagga
ggccactacgaggagtaccagggcagcttgcctgacgcctacagcggcgaccacgacaga
tccagcaacagttacggccggagcgaccgctactcgaggggtcgagaccgggtaggcaga
ccggatcgtgggctccctctgcccatggaaacgggcagccctcccctgcatgattcttac
agccggtcaggctgcagggtgcccaggggcggaggccgtcaaggaggccgcttcgagagg
ggggaaggccggagcagatactaa

DBGET integrated database retrieval system