KEGG   Homo sapiens (human): 139886
Entry
139886            CDS       T01001                                 

Gene name
SPIN4, TDRD28
Definition
(RefSeq) spindlin family member 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Spin-Ssty
Other DBs
NCBI-GeneID: 139886
NCBI-ProteinID: NP_001012986
HGNC: 27040
Ensembl: ENSG00000186767
Vega: OTTHUMG00000021696
Pharos: Q56A73(Tdark)
UniProt: Q56A73
Structure
PDB: 
4UY4

Position
Xq11.1
AA seq 249 aa
MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWK
GTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIG
KAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIP
DSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHI
YVYGLVKTP
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtctcctccaaccgtgcctccgatgggggtagatggcgtgtccgcatacctgatgaag
aaaaggcacacccacaggaagcaacggcgcaagcccactttcctcactcgtaggaacatc
gtgggctgccgcattcaacacggctggaaggaaggcaacgagccagtggagcagtggaag
ggtactgtgctcgagcaggtttccgtgaagcccactctttacatcattaaatatgatggc
aaagatagtgtgtatggactagaactgcaccgcgataagagagttttagcgctagagatc
cttcctgagagagtgccaactcctcgtatcgattcacgactggcagattccctgattggc
aaggcagtggagcatgtgtttgaaggtgaacatggtaccaaggatgaatggaagggtatg
gtcctggcgcgagctcctgtgatggatacttggttttacatcacctacgagaaagatcct
gttctctatatgtacacgctgcttgatgactacaaagatggtgacttacgcattattcca
gattccaactactatttccctacagcagaacaggagcctggagaggtggtcgacagtctc
gtgggcaagcaggtggagcatgccaaagatgacgggtccaagagaactggcatttttata
catcaagtggtggcgaagccatctgtttacttcattaagtttgatgatgatattcacatt
tatgtctatggtttggtgaaaactccttaa

DBGET integrated database retrieval system