KEGG   Homo sapiens (human): 1399Help
Entry
1399              CDS       T01001                                 

Gene name
CRKL
Definition
(RefSeq) CRK like proto-oncogene, adaptor protein
  KO
K04438  proto-oncogene C-crk
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05220  Chronic myeloid leukemia
Network
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1399 (CRKL)
   04010 MAPK signaling pathway
    1399 (CRKL)
   04012 ErbB signaling pathway
    1399 (CRKL)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1399 (CRKL)
  Cell motility
   04810 Regulation of actin cytoskeleton
    1399 (CRKL)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1399 (CRKL)
   04062 Chemokine signaling pathway
    1399 (CRKL)
  Endocrine system
   04910 Insulin signaling pathway
    1399 (CRKL)
  Nervous system
   04722 Neurotrophin signaling pathway
    1399 (CRKL)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1399 (CRKL)
   05206 MicroRNAs in cancer
    1399 (CRKL)
   05220 Chronic myeloid leukemia
    1399 (CRKL)
   05211 Renal cell carcinoma
    1399 (CRKL)
  Infectious diseases
   05131 Shigellosis
    1399 (CRKL)
   05100 Bacterial invasion of epithelial cells
    1399 (CRKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Motif
Other DBs
NCBI-GeneID: 1399
NCBI-ProteinID: NP_005198
OMIM: 602007
HGNC: 2363
Ensembl: ENSG00000099942
Vega: OTTHUMG00000150807
Pharos: P46109(Tbio)
UniProt: P46109
Structure
PDB: 

Position
22q11.21
AA seq 303 aa AA seqDB search
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtatatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccaccctcatcgag
cctgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaac
gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

DBGET integrated database retrieval system