KEGG   Homo sapiens (human): 140459
Entry
140459            CDS       T01001                                 
Symbol
ASB6
Name
(RefSeq) ankyrin repeat and SOCS box containing 6
  KO
K10328  ankyrin repeat and SOCS box protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    140459 (ASB6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     140459 (ASB6)
SSDB
Motif
Pfam: Ank_4 Ank Ank_2 Ank_5 Ank_3 SOCS_box
Other DBs
NCBI-GeneID: 140459
NCBI-ProteinID: NP_060343
OMIM: 615051
HGNC: 17181
Ensembl: ENSG00000148331
Pharos: Q9NWX5(Tdark)
UniProt: Q9NWX5
Position
9:complement(129634605..129642151)
AA seq 421 aa
MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKA
HSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVE
LLVHHGADVNRRDRIHESSPLDLASEEPERLPCLQRLLDLGADVNAADKHGKTALLHALA
SSDGVQIHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVGGDKEEAQMINRFCF
QVTRLLLAHGADPSECPAHESLTHICLKSFKLHFPLLRFLLESGAAYNCSLHGASCWSGF
HIIFERLCSHPGCTEDESHADLLRKAETVLDLMVTNSQKLQLPENFDIHPVGSLAEKIQA
LHFSLRQLESYPPPLKHLCRVAIRLYLQPWPVDVKVKALPLPDRLKWYLLSEHSGSVEDD
I
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgccgttcctgcacggcttccggaggatcatcttcgagtaccagccgctggtggatgcg
attctgggctccctggggatccaggaccccgagcggcaggagtctctggaccggcccagt
tatgtcgccagcgaggagagccgaatccttgttctcactgagctgctggagaggaaagcc
cactctcccttttaccaggaaggcgtgagcaacgccctgctcaagatggctgagctgggg
ctgacgcgggcggccgacgttctcttgcggcatggggccaatctcaactttgaagaccca
gtcacctactacacggccttgcacatcgccgtcctgcggaaccagccggacatggtggag
ctgctggtgcatcacggggccgacgttaatcggagggaccggatccacgagagtagcccc
ttggacctggccagcgaggagcctgagcgcctgccctgcctgcagcgcctcctggacctt
ggagctgatgtcaatgccgctgacaagcatggaaaaactgctctgctccatgctctggcc
agcagcgacggggtgcagatccacaatactgagaacattcgtctcttactggaaggaggg
gcagacgtcaaggccaccaccaaagatggggacacagtgttcacctgcatcatcttcctg
cttggtgagaccgtgggaggggacaaagaggaggcccagatgatcaaccgcttctgcttc
caagtcacacggctgctgctggcacacggggccgaccccagcgagtgcccagcccacgag
tccctcacccacatctgcctgaagagctttaaactgcacttccctctcctgcgcttcctc
ctggagtccggagccgcctacaactgctccctgcacggtgcgtcctgctggtctggcttt
cacatcatctttgagaggctctgttcccacccaggctgcacggaagacgagagccatgcg
gacctcctgcgcaaagctgagactgtcctggatctcatggtgaccaactctcagaaactc
cagctgcccgaaaacttcgatatccaccctgtgggcagcctggcggaaaagatccaggcc
ctccacttctccttgaggcagctggagagctatcccccgcccctcaagcacctgtgccgt
gtggccatccggctctaccttcagccgtggcctgtggatgtgaaggtcaaagccctgcct
ctgcccgacaggctgaagtggtacctccttagcgagcacagtggctccgtggaagatgac
atctga

DBGET integrated database retrieval system