KEGG   Homo sapiens (human): 140461
Entry
140461            CDS       T01001                                 

Gene name
ASB8, PP14212
Definition
(RefSeq) ankyrin repeat and SOCS box containing 8
  KO
K10330  ankyrin repeat and SOCS box protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    140461 (ASB8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     140461 (ASB8)
SSDB
Motif
Pfam: Ank_4 Ank Ank_2 Ank_3 Ank_5 SOCS_box
Other DBs
NCBI-GeneID: 140461
NCBI-ProteinID: NP_001306225
OMIM: 615053
HGNC: 17183
Ensembl: ENSG00000177981
Vega: OTTHUMG00000167834
Pharos: Q9H765(Tdark)
UniProt: Q9H765
Position
12q13.11
AA seq 288 aa
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVI
NLIGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVARDPQLCEKL
TVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPASLKEYLLLLE
NT seq 867 nt   +upstreamnt  +downstreamnt
atgagttccagtatgtggtatattatgcagagcattcagagcaaatactctctctccgag
cgcttaatccgaacaattgctgccatccgttccttcccacatgataatgtagaggacctc
atcagagggggagcagatgtgaactgcactcatggcacactgaagcccttgcactgtgcc
tgtatggtgtcagatgctgactgtgtggagttacttctggaaaaaggagccgaggtgaat
gccctggatgggtataaccgaacagccctccactatgcagcagagaaagatgaggcttgt
gtggaggtcctattggagtatggtgcaaaccccaatgctttggatggcaacagagatacc
ccacttcactgggcagcctttaagaacaatgctgagtgtgtgcgggctctcctagagagc
ggggcctctgtcaatgccctggattacaacaatgatacaccgctcagctgggctgccatg
aagggaaatcttgagagtgtcagcatccttctggattatggcgcagaggtcagagtcatc
aacctaataggccagacacccatctcccgcctggtggctctgctagtcaggggacttgga
acagagaaagaggactcttgctttgagctcctccacagagctgttggacactttgaattg
aggaaaaatggcaccatgccacgagaggtggccagagacccgcagctatgtgaaaaactg
actgttctgtgctcagctccaggaactctaaaaacactcgctcgctatgccgtgcgccgt
agcctgggactccagtatctccccgatgcagtgaagggccttccactgccagcttctttg
aaggaatacctgttacttttagaatag

DBGET integrated database retrieval system