KEGG   Homo sapiens (human): 140462
Entry
140462            CDS       T01001                                 
Symbol
ASB9
Name
(RefSeq) ankyrin repeat and SOCS box containing 9
  KO
K10331  ankyrin repeat and SOCS box protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    140462 (ASB9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     140462 (ASB9)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5 SOCS_box
Other DBs
NCBI-GeneID: 140462
NCBI-ProteinID: NP_001026909
OMIM: 300890
HGNC: 17184
Ensembl: ENSG00000102048
Pharos: Q96DX5(Tbio)
UniProt: Q96DX5 A0A024RBW7
Structure
Position
X:complement(15243987..15270467)
AA seq 294 aa
MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGW
AVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNL
LLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQR
ACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVP
PESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggatggcaaacaagggggcatggatgggagcaagcccgcggggccaagggactttcct
ggcatcaggcttctttcaaacccattgatgggcgatgctgtgtctgattggtctcctatg
catgaagctgcaatccacggacatcagctgtctctgaggaacctcatcagccaggggtgg
gctgtgaacatcatcacggcagatcatgtttccccactccatgaagcctgtcttggaggt
catctctcttgtgtgaagattttattaaagcatggagctcaggtgaatggtgtgacagca
gactggcacactccactgtttaatgcttgtgtcagcggcagctgggattgtgtgaatttg
cttctgcagcacggagccagcgttcaacctgagagtgatctggcatcccccatccatgaa
gctgctaggagaggccacgtggagtgtgtcaactctcttatagcttatgggggcaacatt
gaccataagatcagccacctgggcactccactctatttggcttgtgaaaaccaacagaga
gcctgtgtcaagaagcttctggagtcaggagcggacgtgaaccaagggaaaggtcaggat
tccccacttcatgcagtggccaggacagccagtgaagagctggcctgcctgctcatggat
tttggagcggacacccaggccaagaatgctgaaggcaaacgtcctgtggagctggtgcct
ccagagagccccttggcccagctcttcttggagagagaagggcccccttctttgatgcag
ttatgccgccttagaattcggaagtgttttggaatccagcagcatcataagataaccaaa
ctcgtcctcccagaggatctgaaacagtttctcctacatctttaa

DBGET integrated database retrieval system