KEGG   Homo sapiens (human): 140469Help
Entry
140469            CDS       T01001                                 

Gene name
MYO3B
Definition
(RefSeq) myosin IIIB
  KO
K08834  myosin III [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    140469 (MYO3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    140469 (MYO3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     140469 (MYO3B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   140469 (MYO3B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     140469 (MYO3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Pkinase Pkinase_Tyr IQ APH Pkinase_fungal Kinase-like AAA_22 APS_kinase ABC_tran AAA_16
Motif
Other DBs
NCBI-GeneID: 140469
NCBI-ProteinID: NP_620482
OMIM: 610040
HGNC: 15576
Ensembl: ENSG00000071909
Vega: OTTHUMG00000154002
Pharos: Q8WXR4(Tdark)
UniProt: Q8WXR4 B7ZM71
Position
2q31.1
AA seq 1341 aa AA seqDB search
MKHLYGLFHYNPMMLGLESLPDPTDTWEIIETIGKGTYGKVYKVTNKRDGSLAAVKILDP
VSDMDEEIEAEYNILQFLPNHPNVVKFYGMFYKADHCVGGQLWLVLELCNGGSVTELVKG
LLRCGQRLDEAMISYILYGALLGLQHLHNNRIIHRDVKGNNILLTTEGGVKLVDFGVSAQ
LTSTRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFDMH
PVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQCLIKDFERRPSVTHLLDHPFIKGVHGKV
LFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTII
HQLQKRYADLLIYTYVGDILIALNPFQNLSIYSPQFSRLYHGVKRASNPPHIFASADAAY
QCMVTLSKDQCIVISGESGSGKTESAHLIVQHLTFLGKANNQTLREKILQVNSLVEAFGN
SCTAINDNSSRFGKYLEMMFTPTGVVMGARISEYLLEKSRVIKQAAREKNFHIFYYIYAG
LHHQKKLSDFRLPEEKPPRYIADETGRVMHDITSKESYRRQFEAIQHCFRIIGFTDKEVH
SVYRILAGILNIGNIEFAAISSQHQTDKSEVPNAEALQNAASVLCISPEELQEALTSHCV
VTRGETIIRANTVDRAADVRDAMSKALYGRLFSWIVNRINTLLQPDENICSAGGGMNVGI
LDIFGFENFQRNSFEQLCINIANEQIQYYFNQHVFALEQMEYQNEGIDAVPVEYEDNRPL
LDMFLQKPLGLLALLDEESRFPQATDQTLVDKFEDNLRCKYFWRPKGVELCFGIQHYAGK
VLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLTKTGNLAQTRARITVASSSL
PPHFSAGKAKVDTLEVIRHPEETTNMKRQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPN
DDREALQFSRERVLAQLRSTGILETVSIRRQGYSHRILFEEFVKRYYYLAFTAHQTPLAS
KESCVAILEKSRLDHWVLGKTKVFLKYYHVEQLNLLLREVIGRVVVLQAYTKGWLGARRY
KRVREKREKGAIAIQSAWRGYDARRKFKKISNRRNESAAHNQAGDTSNQSSGPHSPVAAG
TRGSAEVQDCSEPGDHKVLRGSVHRRSHSQAESNNGRTQTSSNSPAVTEKNGHSQAQSSP
KGCDIFAGHANKHSVSGTDLLSSRICHPAPDQQGLSLWGAPQKPGSENGLAQKHRTPRRR
CQQPKMLSSPEDTMYYNQLNGTLEYQGSKRKPRKLGQIKVLDGEDEYYKSLSPVDCIPEE
NNSAHPSFFSSSSKGDSFAQH
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatctgtatggattatttcactataatcctatgatgcttggacttgaatcactt
ccagatcccacagacacctgggaaattatagagaccattggtaaaggcacctatggcaaa
gtctacaaggtaactaacaagagagatgggagcctggctgcagtgaaaattctggatcca
gtcagtgatatggatgaagaaattgaggcagaatacaacattttgcagttccttcctaat
catcccaatgttgtaaagttttatgggatgttttacaaagcggatcactgtgtaggggga
cagctgtggctggtcctggagctgtgtaatgggggctcagtcactgagcttgtcaaaggt
ctactcagatgtggccagcggttggatgaagcaatgatctcatacatcttgtacggggcc
ctcttgggccttcagcatttgcacaacaaccgaatcatccaccgtgatgtgaaggggaat
aacattcttctgacaacagaaggaggagttaagctcgttgactttggtgtttcagctcaa
ctcaccagtacacgtctgcggagaaacacatctgttggcaccccgttctggatggcccct
gaggtcattgcctgtgagcagcagtatgactcttcctatgacgctcgctgtgacgtctgg
tccttggggatcacagctattgaactgggggatggagaccctcccctctttgacatgcat
cctgtgaaaacactctttaagattccaagaaatcctccacctactttacttcatccagaa
aaatggtgtgaagaattcaaccactttatttcacagtgtcttattaaggattttgaaagg
cgaccttccgtcacacatctccttgaccacccatttattaaaggagtacatggaaaagtt
ctgtttctgcaaaaacagctggccaaggttctccaagaccagaagcatcaaaatcctgtt
gctaaaaccaggcatgagaggatgcataccagaagaccttatcatgtggaagatgctgaa
aaatactgccttgaggatgatttggtcaacctagaggttctggatgaggatacaattatc
catcagttgcagaaacgttatgcagacttgctaatttacacatatgttggagacatctta
attgccttaaaccccttccagaatctaagcatatactctccacagttttccagactttat
catggggtgaaacgcgcctccaatcccccccacatatttgcatcagcagatgctgcttac
cagtgcatggttactctcagcaaagaccagtgcattgtcatcagcggagagagtggctct
gggaagacagaaagcgcccacctgattgttcagcatttgactttcttgggaaaggccaat
aatcagaccttgagagagaaaattctacaagtcaactccctggtggaagcctttgggaac
tcatgcactgccatcaatgacaactcgagccgttttggaaaatatctggaaatgatgttt
acaccaactggagttgtgatgggggcaagaatctctgaatatctcctggaaaaatccaga
gttataaaacaggcagcgagagagaaaaattttcatatattttactatatttatgctggt
cttcatcaccaaaagaagctttctgatttcagacttcctgaggaaaaacctcctaggtac
atagctgatgaaactggaagggtgatgcacgacataacttccaaggagtcttacagaaga
caattcgaagcaattcagcattgcttcaggattatagggttcacggacaaagaggtgcac
tcagtgtacagaattttggctgggattttgaatattgggaacattgagttcgcagctatt
tcctctcaacatcagactgataaaagtgaggtgcccaatgctgaagctttgcaaaatgct
gcctctgttctgtgcattagccctgaagagctccaggaggccctcacctcccactgtgtg
gtcacccggggcgagaccatcatccgtgccaacactgtagacagggctgcggacgttcga
gacgccatgtccaaagccctgtatgggaggctcttcagctggattgtgaatcgcattaat
acactcctgcagccagacgaaaacatatgtagtgcaggaggtggaatgaatgtggggatc
ttggatatctttggattcgagaattttcagagaaattcatttgagcagctctgcataaac
atcgccaatgagcaaatccagtactatttcaatcagcatgtttttgctcttgagcagatg
gaatatcagaatgaaggcattgatgctgtacccgtggaatatgaggacaaccgcccgctc
ttggacatgttcctccagaaacccctgggactgcttgcacttttggatgaggaaagtcgg
tttccccaagcaactgaccagaccctggttgataaatttgaagataatctacgatgcaaa
tacttctggaggcccaaaggagtggaactgtgctttggcattcagcattatgctggaaag
gtattatatgatgcttctggggttcttgagaaaaatagagacactctccctgccgatgtg
gttgtggtcctgagaacgtcagaaaacaagcttcttcagcagctcttctcaatccctctg
accaaaacaggtaatttggcccagacaagagctaggataacagtggcctcaagttctttg
cctccacatttcagtgctgggaaagccaaggtggacactctggaggtgatacggcatccg
gaagaaaccaccaacatgaagaggcaaactgtggcttcttacttccggtattctctgatg
gacctgctctccaaaatggtggttggacagccccactttgtgcgctgcattaaacccaat
gatgaccgagaggccctgcagttctctcgagagagggtgctggcccagctccgctccaca
gggattctggagacagtcagcatccgccgccagggctattcccaccgcatcctttttgaa
gaatttgtgaaaaggtattattacttggcattcacagcacatcaaacacctcttgctagc
aaagagagctgtgtggctatcttggaaaagtccagattagatcactgggtactgggaaaa
acaaaggtttttctcaaatattaccatgttgagcaattaaatttgctgcttcgagaagtc
ataggcagagtggttgtgctgcaggcatataccaaggggtggcttggagccaggagatac
aaaagggtcagagagaagagagagaagggagccattgccatccagtcagcctggagagga
tatgatgctcggaggaaatttaagaaaataagcaacagaaggaatgagtctgctgctcat
aatcaagcaggggacacttcaaaccaaagcagtgggccacattcccccgtcgcagcaggt
acgaggggaagtgccgaggttcaagactgcagcgagcctggtgaccataaagttctcagg
ggctctgtacatcgtaggagccattcacaagcagaatccaacaatggccgtacacagact
tcaagcaactctcctgctgtcacagagaaaaatgggcattcacaagcccagagttctcca
aaagggtgcgatatcttcgcaggacatgcaaacaagcactcggtttctgggactgatttg
ctgtcttctcggatatgccatcctgctccagatcagcaaggattgagtctctggggagcc
cctcaaaagcctggttcagaaaatggtcttgcacagaagcatcgaacacctcgccgacga
tgtcagcagcccaaaatgctgagtagccctgaggacaccatgtactataaccagttaaat
ggaactctagaatatcaagggagcaagaggaagccaagaaaacttggccaaatcaaagta
cttgatggggaagatgaatattacaaatctctgtcaccagtggactgtatccctgaggag
aacaactcagcccacccttcctttttttcttcatcctcaaaaggagactcttttgctcaa
cattaa

DBGET integrated database retrieval system