KEGG   Homo sapiens (human): 140596Help
Entry
140596            CDS       T01001                                 

Gene name
DEFB104A, BD-4, DEFB-4, DEFB104, DEFB4, hBD-4
Definition
(RefSeq) defensin beta 104A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 140596
NCBI-ProteinID: NP_525128
HGNC: 18115
Ensembl: ENSG00000176782
Vega: OTTHUMG00000150014
UniProt: Q8WTQ1
Structure
PDB: 

Position
8p23.1
AA seq 72 aa AA seqDB search
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLR
KWDESLLNRTKP
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgcagagacttgtgctgctattagccatttctcttctactctatcaagatcttccagtg
agaagcgaatttgaattggacagaatatgtggttatgggactgcccgttgccggaagaaa
tgtcgcagccaagaatacagaattggaagatgtcccaacacctatgcatgctgtttgaga
aaatgggatgagagcttactgaatcgtacaaaaccctga

DBGET integrated database retrieval system