KEGG   Homo sapiens (human): 140628
Entry
140628            CDS       T01001                                 

Gene name
GATA5, CHTD5, GATAS, bB379O24.1
Definition
(RefSeq) GATA binding protein 5
  KO
K17896  GATA-binding protein 5
Organism
hsa  Homo sapiens (human)
Disease
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    140628 (GATA5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    140628 (GATA5)
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon ArfGap Vps36-NZF-N
Other DBs
NCBI-GeneID: 140628
NCBI-ProteinID: NP_536721
OMIM: 611496
HGNC: 15802
Ensembl: ENSG00000130700
Vega: OTTHUMG00000032919
Pharos: Q9BWX5(Tbio)
UniProt: Q9BWX5
Position
20q13.33
AA seq 397 aa
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAA
RPGWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGAL
LPREQFAAPLGRPVGTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLE
EFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAG
LCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHL
EFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtaccagagcctggcgctggccgcgagcccccgccaggccgcctacgccgactcgggc
tccttcctgcacgctccgggcgccggctctccgatgtttgtgccgccggcgcgcgtcccc
tcgatgctgtcctacctgtccgggtgtgagccgagcccgcagccccccgagctcgctgcg
cgccccggctgggcgcagacagccaccgcggattcgtcggccttcggcccgggcagtccg
caccccccagccgcgcacccgcccggggccaccgccttccctttcgcgcacagcccctcg
gggcccggcagcggcggcagcgcggggggccgagacggcagtgcctaccagggcgcgctg
ttgcctcgagaacagttcgcggccccgcttgggcggccggtggggacctcgtactccgcc
acctacccggcctacgtgagccccgacgtggcccagtcctggactgccgggcccttcgat
ggcagcgtcctgcacggcctcccaggccgcaggcccaccttcgtgtccgacttcttggag
gagttcccgggtgagggtcgtgagtgtgtcaactgcggggccctgtccacaccgctgtgg
cgccgagacggcaccggccactacctgtgcaatgcctgcggcctctaccacaagatgaat
ggcgtcaaccggccgctcgttcggcctcagaagcgcctgtcctcgtcccgccgcgccggc
ctctgctgcaccaactgccacacgaccaacaccacgctgtggcggcggaactcggagggg
gagcccgtgtgcaatgcctgcggcctctacatgaagctgcacggggtgccgcggcctctg
gctatgaagaaggaaagcatccagacacggaagcggaagccaaagaccatcgccaaggcc
aggggctcctcaggatccacaaggaatgcctcggcctccccatctgctgtcgccagcact
gacagctcagcagccacttcgaaagccaagcccagcctggcgtccccagtgtgccctggg
cccagcatggccccccaggcctctggccaggaggatgactctcttgcccccggccacttg
gagttcaagttcgagcctgaggactttgccttcccctccacggccccaagcccccaggct
ggcctcaggggggctctgcgccaagaggcctggtgtgcgctggccttggcctag

DBGET integrated database retrieval system