KEGG   Homo sapiens (human): 140679
Entry
140679            CDS       T01001                                 

Gene name
SLC32A1, VGAT, VIAAT
Definition
(RefSeq) solute carrier family 32 member 1
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    140679 (SLC32A1)
   04723 Retrograde endocannabinoid signaling
    140679 (SLC32A1)
   04721 Synaptic vesicle cycle
    140679 (SLC32A1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    140679 (SLC32A1)
   05033 Nicotine addiction
    140679 (SLC32A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    140679 (SLC32A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   140679 (SLC32A1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 140679
NCBI-ProteinID: NP_542119
OMIM: 616440
HGNC: 11018
Ensembl: ENSG00000101438
Vega: OTTHUMG00000032457
Pharos: Q9H598(Tbio)
UniProt: Q9H598
Position
20q11.23
AA seq 525 aa
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccaccttgctccgcagcaagctgtccaacgtggccacgtccgtgtccaacaagtcc
caggccaagatgagcggcatgttcgccaggatgggttttcaggcggccacggatgaggag
gcggtgggcttcgcgcattgcgacgacctcgactttgagcaccgccagggcctgcagatg
gacatcctgaaagccgagggagagccctgcggggacgagggcgctgaagcgcccgtcgag
ggagacatccattatcagcgaggcagcggagctcctctgccgccctccggctccaaggac
caggtgggaggtggtggcgaattcgggggccacgacaagcccaaaatcacggcgtgggag
gcaggctggaacgtgaccaacgccatccagggcatgttcgtgctgggcctaccctacgcc
atcctgcacggcggctacctggggttgtttctcatcatcttcgccgccgttgtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaatgaagacggcgaggtggtg
cgcgtgcgggactcgtacgtggccatagccaacgcctgctgcgccccgcgcttcccaacg
ctgggcggccgagtggtgaacgtagcgcagatcatcgagctggtgatgacgtgcatcctg
tacgtggtggtgagtggcaacctcatgtacaacagcttcccggggctgcccgtgtcgcag
aagtcctggtccattatcgccacggccgtgctgctgccttgcgccttccttaagaacctc
aaggccgtgtccaagttcagtctgctgtgcactctggcccacttcgtcatcaatatcctg
gtcatagcctactgtctatcgcgggcgcgcgactgggcctgggagaaggtcaagttctac
atcgacgtcaagaagttccccatctccattggcatcatcgtgttcagctacacgtctcag
atcttcctgccttcgctggagggcaatatgcagcagcccagcgagttccactgcatgatg
aactggacgcacatcgcagcctgcgtgctcaagggcctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaggtcatcacggataacctgcccggctccatccgcgcc
gtggtcaacatctttctggtggccaaggcgctgttgtcctatcctctgccattctttgcc
gctgtcgaggtgctggagaagtcgctcttccaggaaggcagccgcgcctttttcccggcc
tgctacagcggcgacgggcgcctgaagtcctgggggctgacgctgcgctgcgcgctcgtc
gtcttcacgctgctcatggccatttatgtgccgcacttcgcgctgctcatgggcctcacc
ggcagcctcacgggcgccggcctctgtttcttgctgcccagcctctttcacctgcgcctg
ctctggcgcaagctgctgtggcaccaagtcttcttcgacgtcgccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcactccctcgagggcctcatcgaagcctaccga
accaacgcggaggactag

KEGG   Homo sapiens (human): 246213
Entry
246213            CDS       T01001                                 

Gene name
SLC17A8, DFNA25, VGLUT3
Definition
(RefSeq) solute carrier family 17 member 8
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    246213 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    246213 (SLC17A8)
   04721 Synaptic vesicle cycle
    246213 (SLC17A8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    246213 (SLC17A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    246213 (SLC17A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   246213 (SLC17A8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    246213 (SLC17A8)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 246213
NCBI-ProteinID: NP_647480
OMIM: 607557
HGNC: 20151
Ensembl: ENSG00000179520
Vega: OTTHUMG00000170358
Pharos: Q8NDX2(Tbio)
UniProt: Q8NDX2
Position
12q23.1
AA seq 589 aa
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRP
SPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSL
SKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHESFA
SPKKKMSYGATSQNCEVQKKEWKGQRGATLDEEELTSYQNEERNFSTIS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccttttaaagcatttgataccttcaaagaaaaaattctgaaacctgggaaggaagga
gtgaagaacgccgtgggagattctttgggaattttacaaagaaaaatcgatgggacaact
gaggaagaagataacattgagctgaatgaagaaggaaggccggtgcagacgtccaggcca
agccccccactctgcgactgccactgctgcggcctccccaagcgttacatcattgctatc
atgagtgggctgggattctgcatttcctttgggatccggtgcaatcttggagttgccatt
gtggaaatggtcaacaatagcaccgtatatgttgatggaaaaccggaaattcagacagca
cagtttaactgggatccagaaacagtgggccttatccatggatcttttttctggggctat
attatgacacaaattccaggtggtttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttaacatcgactctgaacatgtttattccctctgcagccagagtg
cattacggatgcgtcatgtgtgtcagaattctgcaaggtttagtggagggtgtgacctac
ccagcctgccatgggatgtggagtaagtgggcaccacctttggagagaagccgactggcc
acaacctctttttgtggttcctatgcaggggcagtggttgccatgcccctggctggggtg
ttggtgcagtacattggatggtcctctgtcttttatatttatggcatgtttgggattatt
tggtacatgttttggctgttgcaggcctatgagtgcccagcagctcatccaacaatatcc
aatgaggagaagacctatatagagacaagcataggagagggggccaacgtggttagtcta
agtaaatttagtaccccatggaaaagatttttcacatctttgccggtttatgcaatcatt
gtggcaaatttttgcagaagctggaccttttatttgctcctcataagtcagcctgcttat
tttgaagaggtctttggatttgcaataagtaaggtgggtctcttgtcagcagtcccacac
atggttatgacaatcgttgtacctattggaggacaattggctgattatttaagaagcaga
caaattttaaccacaactgctgtcagaaaaatcatgaactgtggaggttttggcatggag
gcaaccttactcctggtggttggcttttcgcataccaaaggggtggctatctcctttctg
gtacttgctgtaggatttagtggcttcgctatttcaggttttaatgtcaaccacctggac
attgccccacgctatgccagcattctcatggggatctcaaacggagtgggaaccctctct
ggaatggtctgtcccctcattgtcggtgcaatgaccaggcacaagacccgtgaagaatgg
cagaatgtgttcctcatagctgccctggtgcattacagtggtgtgatcttctatggggtc
tttgcttctggggagaaacaggagtgggctgacccagagaatctctctgaggagaaatgt
ggaatcattgaccaggacgaattagctgaggagatagaactcaaccatgagagttttgcg
agtcccaaaaagaagatgtcttatggagccacctcccagaattgtgaagtccagaagaag
gaatggaaaggacagagaggagcgacccttgatgaggaagagctgacatcctaccagaat
gaagagagaaacttctcaactatatcctaa

KEGG   Homo sapiens (human): 57030
Entry
57030             CDS       T01001                                 

Gene name
SLC17A7, BNPI, VGLUT1
Definition
(RefSeq) solute carrier family 17 member 7
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    57030 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    57030 (SLC17A7)
   04721 Synaptic vesicle cycle
    57030 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    57030 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57030 (SLC17A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   57030 (SLC17A7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    57030 (SLC17A7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 57030
NCBI-ProteinID: NP_064705
OMIM: 605208
HGNC: 16704
Ensembl: ENSG00000104888
Vega: OTTHUMG00000183166
Pharos: Q9P2U7(Tbio)
UniProt: Q9P2U7
Position
19q13.33
AA seq 560 aa
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccgccaggaggagtttcggaagctagcgggtcgtgctctcgggaagctgcac
cgccttctggagaagcggcaggaaggcgcggagacgctggagctgagtgcggatgggcgc
ccggtgaccacgcagacccgggacccgccggtggtggactgcacctgcttcggcctccct
cgccgctacattatcgccatcatgagtggtctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaataacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagcccagttcagctgggatccagagactgtcggcctcatacac
ggctcctttttctggggctacattgtcactcagattccaggaggatttatctgtcaaaaa
tttgcagccaacagagttttcggctttgctattgtggcaacatccactctaaacatgctg
atcccctcagctgcccgcgtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacataccccgcctgccatgggatctggagcaaatgggccccaccc
ttagaacggagtcgcctggcgacgacagccttttgtggttcctatgctggggcggtggtc
gcgatgcccctcgccggggtccttgtgcagtactcaggatggagctctgttttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcctacgagtccccc
gcgctgcaccccagcatctcggaggaggagcgcaagtacatcgaggacgccatcggagag
agcgcgaaactcatgaaccccctcacgaagtttagcactccctggcggcgcttcttcacg
tctatgccagtctatgccatcatcgtggccaacttctgccgcagctggacgttctacctg
ctgctcatctcccagcccgcctacttcgaagaagtgttcggcttcgagatcagcaaggta
ggcctggtgtccgcgctgccccacctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgcggagccgccgcatcatgtccaccaccaacgtgcgcaagttgatg
aactgcggaggcttcggcatggaagccacgctgctgttggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctagccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatagccccgcgctacgccagcatcctcatgggcatc
tccaacggcgtgggcacactgtcgggcatggtgtgccccatcatcgtgggggccatgact
aagcacaagactcgggaggagtggcagtacgtgttcctaattgcctccctggtgcactat
ggaggtgtcatcttctacggggtctttgcttctggagagaagcagccgtgggcagagcct
gaggagatgagcgaggagaagtgtggcttcgttggccatgaccagctggctggcagtgac
gacagcgaaatggaggatgaggctgagcccccgggggcaccccctgcacccccgccctcc
tatggggccacacacagcacatttcagccccccaggcccccaccccctgtccgggactac
tga

KEGG   Homo sapiens (human): 57084
Entry
57084             CDS       T01001                                 

Gene name
SLC17A6, DNPI, VGLUT2
Definition
(RefSeq) solute carrier family 17 member 6
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    57084 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    57084 (SLC17A6)
   04721 Synaptic vesicle cycle
    57084 (SLC17A6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    57084 (SLC17A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57084 (SLC17A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   57084 (SLC17A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    57084 (SLC17A6)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 57084
NCBI-ProteinID: NP_065079
OMIM: 607563
HGNC: 16703
Ensembl: ENSG00000091664
Vega: OTTHUMG00000166063
Pharos: Q9P2U8(Tbio)
UniProt: Q9P2U8
Position
11p14.3
AA seq 582 aa
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggaatccgtaaaacaaaggattttggccccaggaaaagaggggctaaagaattttgct
ggaaaatcactcggccagatctacagggtgctggagaagaagcaagacaccggggagaca
atcgagctgacggaggatgggaagcccctagaggtgcccgagaggaaggcgccgctgtgc
gactgcacgtgcttcggcctgccccgccgctacattatcgccatcatgagcggcctgggc
ttctgcatctccttcggtatccgctgcaacctgggcgtggccattgtggacatggtcaac
aacagcaccatccaccgcgggggcaaggtcatcaaggagaaagccaaattcaactgggac
ccggaaaccgtggggatgatccacggttccttcttttggggctacatcatcactcagatt
ccgggaggctacatcgcgtctcggctggcagccaacagggttttcggagctgccatactt
cttacctctaccctaaatatgctaattccatcagcagccagagtgcattatggatgtgtc
atctttgtcagaatactgcagggacttgttgagggtgtgacctacccagcatgtcatggg
atatggagcaaatgggccccacctctagagaggagtagactggcaaccacctccttttgt
ggttcctatgccggagctgtgattgcaatgcctttagctggcattcttgtgcagtacact
ggctggtcttcagtgttttatgtctacggaagctttggaatggtctggtacatgttttgg
cttttggtgtcttatgaaagtcctgcaaagcatcctactattacagatgaagaacgtagg
tacatagaagaaagcattggagagagtgcaaatcttttaggtgcaatggaaaaattcaag
actccatggaggaagttttttacatccatgccagtctatgcaataattgttgcaaacttc
tgcagaagctggactttttatttattgcttattagtcagccagcatattttgaggaagtc
tttggatttgaaattagcaaggttggtatgctatctgctgtgccacacttagtaatgaca
attattgtgcctattgggggacaaattgcagattttctaagaagcaagcagattctttca
actacgacagtgagaaagatcatgaattgtggtggttttggcatggaagccacactgctc
ctggtcgttggctattctcatactagaggggtagcaatctcattcttggtacttgcagtg
ggattcagtggatttgctatatctggtttcaatgttaaccacttggatatcgctccaaga
tatgccagtatcttaatgggcatttcgaatggtgttggcacattgtcaggaatggtttgt
cctatcattgttggtgcaatgacaaagaataagtcacgtgaagagtggcagtatgtcttc
ctgatcgctgccctagtccactatggtggagttatattttatgcaatatttgcctcagga
gagaaacaaccctgggcagacccggaggaaacaagtgaagaaaaatgtggatttattcat
gaagatgaactcgatgaagaaacaggggacattactcaaaattatataaattatggtacc
accaagtcttatggtgccacaacacaggccaatggaggttggcctagtggttgggaaaag
aaagaggaatttgtacaaggagaagtacaagactcacatagctataaggaccgagttgat
tattcataa

KEGG   Homo sapiens (human): 6570
Entry
6570              CDS       T01001                                 

Gene name
SLC18A1, CGAT, VAT1, VMAT1
Definition
(RefSeq) solute carrier family 18 member A1
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Network
nt06422  Dopamine metabolism
nt06463  Parkinson disease
  Element
N01040  Transport of dopamine
Drug target
Metamfetamine (DG00968): D02242 D08187
Reserpine: D00197
Tedatioxetine (DG01311): D10170 D10171
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    6570 (SLC18A1)
   04726 Serotonergic synapse
    6570 (SLC18A1)
   04721 Synaptic vesicle cycle
    6570 (SLC18A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6570 (SLC18A1)
  09165 Substance dependence
   05030 Cocaine addiction
    6570 (SLC18A1)
   05031 Amphetamine addiction
    6570 (SLC18A1)
   05034 Alcoholism
    6570 (SLC18A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6570 (SLC18A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   6570 (SLC18A1)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6570 (SLC18A1)
SSDB
Motif
Pfam: MFS_1 DUF5529 CPP1-like
Other DBs
NCBI-GeneID: 6570
NCBI-ProteinID: NP_001129163
OMIM: 193002
HGNC: 10934
Ensembl: ENSG00000036565
Vega: OTTHUMG00000097017
Pharos: P54219(Tchem)
UniProt: P54219 Q96GL6
Position
8p21.3
AA seq 525 aa
MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgctccggaccattctggatgctccccagcggttgctgaaggaggggagagcgtcccgg
cagctggtgctggtggtggtattcgtcgctttgctcctggacaacatgctgtttactgtg
gtggtgccaattgtgcccaccttcctatatgacatggagttcaaagaagtcaactcttct
ctgcacctcggccatgccggaagttccccacatgccctcgcctctcctgccttttccacc
atcttctccttcttcaacaacaacaccgtggctgttgaagaaagcgtacctagtggaata
gcatggatgaatgacactgccagcaccatcccacctccagccactgaagccatctcagct
cataaaaacaactgcttgcaaggcacaggtttcttggaggaagagattacccgggtcggg
gttctgtttgcttcaaaggctgtgatgcaacttctggtcaacccattcgtgggccctctc
accaacaggattggatatcatatccccatgtttgctggctttgttatcatgtttctctcc
acagttatgtttgctttttctgggacctatactctactctttgtggcccgaacccttcaa
ggcattggatcttcattttcatctgttgcaggtcttggaatgctggccagtgtctacact
gatgaccatgagagaggacgagccatgggaactgctctggggggcctggccttggggttg
ctggtgggagctccctttggaagtgtaatgtacgagtttgttgggaagtctgcacccttc
ctcatcctggccttcctggcactactggatggagcactccagctttgcatcctacagcct
tccaaagtctctcctgagagtgccaaggggactcccctctttatgcttctcaaagaccct
tacatcctggtggctgcagggtccatctgctttgccaacatgggggtggccatcctggag
cccacactgcccatctggatgatgcagaccatgtgctcccccaagtggcagctgggtcta
gctttcttgcctgccagtgtgtcctacctcattggcaccaacctctttggtgtgttggcc
aacaagatgggtcggtggctgtgttccctaatcgggatgctggtagtaggtaccagcttg
ctctgtgttcctctggctcacaatatttttggtctcattggccccaatgcagggcttggc
cttgccataggcatggtggattcttctatgatgcccatcatggggcacctggtggatcta
cgccacacctcggtgtatgggagtgtctacgccatcgctgatgtggctttttgcatgggc
tttgctataggtccatccaccggtggtgccattgtaaaggccatcggttttccctggctc
atggtcatcactggggtcatcaacatcgtctatgctccactctgctactacctgcggagc
cccccggcaaaggaagagaagcttgctattctgagtcaggactgccccatggagacccgg
atgtatgcaacccagaagcccacgaaggaatttcctctgggggaggacagtgatgaggag
cctgaccatgaggagtag

KEGG   Homo sapiens (human): 6571
Entry
6571              CDS       T01001                                 

Gene name
SLC18A2, PKDYS2, SVAT, SVMT, VAT2, VMAT2
Definition
(RefSeq) solute carrier family 18 member A2
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Network
nt06422  Dopamine metabolism
nt06463  Parkinson disease
  Element
N01040  Transport of dopamine
N01041  Mutation-caused aberrant SNCA to transport of dopamine
Drug target
Amfetamine (DG00966): D02074 D07445
Amphetamine aspartate monohydrate: D11622
Benzfetamine (DG01755): D07514 D07515
Deutetrabenazine: D10701
Dexamfetamine (DG00967): D02078 D03740
Dextroamphetamine saccharate: D11623
Isometheptene: D07097
Metamfetamine (DG00968): D02242 D08187
Midomafetamine: D11172
Reserpine: D00197
Tedatioxetine (DG01311): D10170 D10171
Tetrabenazine: D08575
Valbenazine (DG02115): D10675 D10999
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    6571 (SLC18A2)
   04726 Serotonergic synapse
    6571 (SLC18A2)
   04721 Synaptic vesicle cycle
    6571 (SLC18A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6571 (SLC18A2)
  09165 Substance dependence
   05030 Cocaine addiction
    6571 (SLC18A2)
   05031 Amphetamine addiction
    6571 (SLC18A2)
   05034 Alcoholism
    6571 (SLC18A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6571 (SLC18A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   6571 (SLC18A2)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6571 (SLC18A2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr S_4TM
Other DBs
NCBI-GeneID: 6571
NCBI-ProteinID: NP_003045
OMIM: 193001
HGNC: 10935
Ensembl: ENSG00000165646
Vega: OTTHUMG00000019121
Pharos: Q05940(Tclin)
UniProt: Q05940
Position
10q25.3
AA seq 514 aa
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccctgagcgagctggcgctggtccgctggctgcaggagagccgccgctcgcggaag
ctcatcctgttcatcgtgttcctggcgctgctgctggacaacatgctgctcactgtcgtg
gtccccatcatcccaagttatctgtacagcattaagcatgagaagaatgctacagaaatc
cagacggccaggccagtgcacactgcctccatctcagacagcttccagagcatcttctcc
tattatgataactcgactatggtcaccgggaatgctaccagagacctgacacttcatcag
accgccacacagcacatggtgaccaacgcgtccgctgttccttccgactgtcccagtgaa
gacaaagacctcctgaatgaaaacgtgcaagttggtctgttgtttgcctcgaaagccacc
gtccagctcatcaccaaccctttcataggactactgaccaacagaattggctatccaatt
cccatatttgcgggattctgcatcatgtttgtctcaacaattatgtttgccttctccagc
agctatgccttcctgctgattgccaggtcgctgcagggcatcggctcgtcctgctcctct
gtggctgggatgggcatgcttgccagtgtctacacagatgatgaagagagaggcaacgtc
atgggaatcgccttgggaggcctggccatgggggtcttagtgggcccccccttcgggagt
gtgctctatgagtttgtggggaagacggctccgttcctggtgctggccgccctggtactc
ttggatggagctattcagctctttgtgctccagccgtcccgggtgcagccagagagtcag
aaggggacacccctaaccacgctgctgaaggacccgtacatcctcattgctgcaggctcc
atctgctttgcaaacatgggcatcgccatgctggagccagccctgcccatctggatgatg
gagaccatgtgttcccgaaagtggcagctgggcgttgccttcttgccagctagtatctct
tatctcattggaaccaatatttttgggatacttgcacacaaaatggggaggtggctttgt
gctcttctgggaatgataattgttggagtcagcattttatgtattccatttgcaaaaaac
atttatggactcatagctccgaactttggagttggttttgcaattggaatggtggattcg
tcaatgatgcctatcatgggctacctcgtagacctgcggcacgtgtccgtctatgggagt
gtgtacgccattgcggatgtggcattttgtatggggtatgctataggtccttctgctggt
ggtgctattgcaaaggcaattggatttccatggctcatgacaattattgggataattgat
attctttttgcccctctctgcttttttcttcgaagtccacctgccaaagaagaaaaaatg
gctattctcatggatcacaactgccctattaaaacaaaaatgtacactcagaataatatc
cagtcatatccgataggtgaagatgaagaatctgaaagtgactga

KEGG   Homo sapiens (human): 6572
Entry
6572              CDS       T01001                                 

Gene name
SLC18A3, CMS21, VACHT
Definition
(RefSeq) solute carrier family 18 member A3
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04725  Cholinergic synapse
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    6572 (SLC18A3)
   04721 Synaptic vesicle cycle
    6572 (SLC18A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6572 (SLC18A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   6572 (SLC18A3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6572 (SLC18A3)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4 BT1
Other DBs
NCBI-GeneID: 6572
NCBI-ProteinID: NP_003046
OMIM: 600336
HGNC: 10936
Ensembl: ENSG00000187714
Vega: OTTHUMG00000018196
Pharos: Q16572(Tchem)
UniProt: Q16572
Position
10q11.23
AA seq 532 aa
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaatccgcggaacctgcgggccaggcccgggcggcggccaccaagctgtcggaggct
gtgggcgcggcgctgcaggagccccggcggcagaggcgcctggtgcttgttatcgtgtgc
gtggcgctgttactggacaacatgctgtacatggtcatcgtgcccatagtgcccgactac
atcgcccacatgcgcgggggcggcgagggccccacccggactcccgaggtgtgggagccc
accctgccgctgcccactccggccaatgccagcgcctacacggccaacacctcggcgtcc
ccgacagctgcgtggccagcgggctcagcccttcggccccgctaccctacggagagcgaa
gacgtgaagatcggggtgctgtttgcttccaaggctatcctgcagctgctagtgaacccc
ttgagcgggcccttcatcgaccgcatgagctacgacgtgccgctgctgatcggcctgggc
gtcatgttcgcctctacagtcctgttcgccttcgccgaggactacgccacgctgttcgcg
gcgcgcagcctgcagggcctgggctcagccttcgccgacacgtctggcatagccatgatc
gccgataagtacccggaggagccggagcgcagtcgtgcactgggcgtggcgctggccttc
attagcttcggaagcctagtggccccgcccttcgggggcatcctctatgagttcgccggc
aagcgcgtgcccttcttggtgctagctgccgtgtcgctctttgacgcgctgttgctgctg
gcagtggccaaacccttctcggcggctgcacgggctcgggccaacctgccagtgggcact
cccatccaccgcctcatgctagacccctacattgccgtggtggccggcgcgctcaccacc
tgtaacattcccctcgccttcctcgaacccaccattgccacgtggatgaagcatacgatg
gcggcttccgagtgggagatgggcatggcctggctgccggccttcgtgcctcatgtgctg
ggcgtctacctcaccgtgcgcctggcggcgcgctacccacacctgcagtggctgtacggc
gcgcttgggctggctgtgatcggcgccagctcgtgcatcgtgcccgcctgccgctccttc
gcgccgctagtggtctcactatgcggcctctgttttggcatagccctagtcgacacagca
ctgctgcccacgctcgccttcctggtggacgtgcgccatgtctcagtctatggcagcgtc
tacgccatcgccgacatctcctattcggtggcctacgcgctcgggcccatagtggcaggc
cacattgtgcactcgctgggctttgagcagctcagccttggcatgggactggccaacctg
ctctatgctcccgtcttgctgctgctccgcaacgtgggcctcctgacgcgctcccgttcc
gagcgcgatgtgctgcttgatgagccaccgcaaggtctgtacgatgcggtgcgcctgcgt
gagcgtcctgtgtctggccaggacggcgagcctcgcagcccgcctggcccttttgatgcg
tgcgaggacgactacaactactactacacccgcagctag

DBGET integrated database retrieval system