KEGG   Homo sapiens (human): 140688
Entry
140688            CDS       T01001                                 
Symbol
NOL4L, C20orf112, C20orf113
Name
(RefSeq) nucleolar protein 4 like
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 140688
NCBI-ProteinID: NP_542183
OMIM: 618893
HGNC: 16106
Ensembl: ENSG00000197183
UniProt: Q96MY1
Position
20:complement(32443059..32585333)
AA seq 436 aa
MSDSTWMSADPHLASSLSPSQDERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSST
QGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRV
KYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSE
GMDPERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRT
YLKSCRRMKKNGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQDEPI
ALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGN
HSNGPTDLSMKGGASTTSTTPTPTPSSTSTSRPVPTAQLSPTEISAVRQLIAGYRESAAF
LLRSADELENLILQQN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagcgactccacatggatgtcagctgacccgcacctggcctccagcctgagccccagc
caggacgagaggatgcggagcccgcagaacctccacagtcaagaggacgatgactcctcc
tctgagagtggcagcggcaatggctcctccaccctgaacccatccacgtcgagcagcacg
cagggcgaccctgccttccccgagatgaatggcaacggcgccgtggcccccatggacttc
accacggccgccgaggatcagcccatcaacctgtgtgacaagctcccgccggccacggca
cttggcacagcctcctacccctcggatggctgcggtgccgacgggctgcggagccgcgtc
aaatacggggtgaagaccacccccgagtcccccccctacagctctgggagctacgattcc
atcaagaccgaggtcagcggctgccctgaggacctgacagtgggccgggccccgacggca
gatgatgacgacgatgaccacgatgaccatgaggacaatgacaagatgaacgactctgaa
ggcatggaccctgagcgtcttaaggccttcaacatgtttgtgcgtctctttgtggacgag
aacctggaccgcatggtgcccatctccaagcagcccaaggagaagatccaggccatcatc
gagtcctgcagccggcagttccctgagttccaggagcgggcccgcaagcgcatccgcacg
tacctcaagtcctgccgtcgcatgaagaagaacggcatggagatgaccagacccacgcca
ccccatctgacctcggccatggcagaaaacatcctggcagctgcctgtgagagcgagaca
agaaaggcagccaagcggatgcgtctagagatctaccagtcctcacaggatgagcccata
gccctggacaagcagcactcgcgggactccgcagccatcacccactccacctactcactg
ccagcctcctcctactcccaggaccctgtgtacgccaacggcggcctcaactacagttac
cgcgggtacggggccttgagcagcaacctgcagccccctgcctccctccaaacaggaaac
cacagtaatgggcccacggacctcagcatgaaaggcggggcctctaccacctccaccacc
cccacgcccaccccctccagcaccagcaccagcaggcccgtgcccaccgctcagctcagc
cccacggagatcagcgccgtgcggcagctcatcgcgggctaccgggagtctgctgccttc
ctgctgcgctctgcagatgaactggaaaacctcatcctacagcagaactga

DBGET integrated database retrieval system