KEGG   Homo sapiens (human): 140690
Entry
140690            CDS       T01001                                 
Symbol
CTCFL, BORIS, CT27, CTCF-T, HMGB1L1, dJ579F20.2
Name
(RefSeq) CCCTC-binding factor like
  KO
K23195  transcriptional repressor CTCF
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    140690 (CTCFL)
   03036 Chromosome and associated proteins [BR:hsa03036]
    140690 (CTCFL)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    140690 (CTCFL)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    140690 (CTCFL)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 Zn-ribbon_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 140690
NCBI-ProteinID: NP_001255969
OMIM: 607022
HGNC: 16234
Ensembl: ENSG00000124092
Pharos: Q8NI51(Tbio)
UniProt: Q8NI51
Position
20:complement(57495965..57525652)
AA seq 663 aa
MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSV
LEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLL
WLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLI
KLEEEQEKNQLLAERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEK
AKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKTFRTVTLL
RNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRH
VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK
HGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTH
KNEKRFKCKHCSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDAN
FIPTVYKCSKCGKGFSRWINLHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQK
EAAKGWKEAANGDEAAAEEASTTKGEQFPGEMFPVACRETTARVKEEVDEGVTCEMLLNT
MDK
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggcagccactgagatctctgtcctttctgagcaattcaccaagatcaaagaactcgag
ttgatgccggaaaaaggcctgaaggaggaggaaaaagacggagtgtgcagagagaaagac
catcggagccctagtgagttggaggccgagcgtacctctggggccttccaggacagcgtc
ctggaggaagaagtggagctggtgctggccccctcggaggagagcgagaagtacatcctg
accctgcagacggtgcacttcacttctgaagctgtggagttgcaggatatgagcttgctg
agcatacagcagcaagaaggggtgcaggtggtggtgcaacagcctggccctgggttgctg
tggcttgaggaagggccccggcagagcctgcagcagtgtgtggccattagtatccagcaa
gagctgtactccccgcaagagatggaggtgttgcagttccacgctctagaggagaatgtg
atggtggccagtgaagacagtaagttagcggtgagcctggctgaaactactggactgatc
aagctcgaggaagagcaggagaagaaccagttattggctgaaagaacaaaggagcagctc
ttttttgtggaaacaatgtcaggagatgaaagaagtgacgaaattgttctcacagtttca
aattcaaatgtggaagaacaagaggatcaacctacagctggtcaagcagatgctgaaaag
gccaaatctacaaaaaatcaaagaaagacaaagggagcaaaaggaaccttccactgtgat
gtctgcatgttcacctcttctagaatgtcaagttttaatcgtcatatgaaaactcacacc
agtgagaagcctcacctgtgtcacctctgcctgaaaaccttccgtacggtcactctgctg
cggaaccatgttaacacccacacaggaaccaggccctacaagtgtaacgactgcaacatg
gcatttgtcaccagtggagaactcgtccgacacaggcgctataaacatactcatgagaaa
ccctttaaatgttccatgtgcaagtatgccagtgtggaggcaagtaaattgaagcgccat
gtccgatcccacactggggagcgcccctttcagtgttgccagtgcagctatgccagcaga
gatacctacaagctgaaacgccacatgagaacgcactcaggtgagaagccttacgaatgc
cacatctgccacacccgcttcacccagagcgggaccatgaaaatacatattctgcagaaa
cacggcgaaaatgtccccaaataccagtgtccccattgtgccaccatcattgcacggaaa
agcgacctacgtgtgcatatgcgcaacttgcatgcttacagcgctgcagagctgaaatgc
cgctactgttctgctgtcttccatgaacgctatgccctcattcagcaccagaaaactcat
aagaatgagaagaggttcaagtgcaaacactgcagttatgcctgcaagcaggaacgtcat
atgaccgctcacattcgtacccacactggagagaaaccattcacctgcctttcttgcaat
aaatgtttccgacagaagcaacttctaaacgctcacttcaggaaataccacgatgcaaat
ttcatcccgactgtttacaaatgctccaagtgtggcaaaggcttttcccgctggattaac
ctgcacagacattcggagaagtgtggatcaggggaagcaaagtcggctgcttcaggaaag
ggaagaagaacaagaaagaggaagcagaccatcctgaaggaagccacaaagggtcagaag
gaagctgcgaagggatggaaggaagccgcgaacggagacgaagctgctgctgaggaggct
tccaccacgaagggagaacagttcccaggagagatgtttcctgtcgcctgcagagaaacc
acagccagagtcaaagaggaagtggatgaaggcgtgacctgtgaaatgctcctcaacacg
atggataagtga

DBGET integrated database retrieval system