KEGG   Homo sapiens (human): 140700
Entry
140700            CDS       T01001                                 

Gene name
SAMD10, C20orf136, dJ591C20, dJ591C20.7
Definition
(RefSeq) sterile alpha motif domain containing 10
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SAM_2 SAM_1 SAM_PNT YdaS_antitoxin
Other DBs
NCBI-GeneID: 140700
NCBI-ProteinID: NP_542188
HGNC: 16129
Ensembl: ENSG00000130590
Vega: OTTHUMG00000033011
Pharos: Q9BYL1(Tdark)
UniProt: Q9BYL1
Position
20q13.33
AA seq 202 aa
MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPG
TSLTWHDSRSQRAASSRPIKLLQQPGTDTPQGRLYSDHYGLYHTSPSLGGLTRPVVLWSQ
QDVCKWLKKHCPHNYLVYVEAFSQHAITGRALLRLNAEKLQRMGLAQEAQRQEVLQQVLR
LQVREEGRSLQLLSQASFGKMS
NT seq 609 nt   +upstreamnt  +downstreamnt
atgttcaccgagctgaggtccaagctgagccccccgcgtggccgcgccggggccgtgcgc
gcgggcttcggggagcgccgggatgtggacgccactgcccacttcagcttctgccggacc
ctcctggagcacacggtgtcagctgagagcatcccctgccacttgcctcggacacctggc
accagcctcacgtggcatgactcccgcagccagagggcggccagcagcaggccaatcaag
ctcctgcagcagcccggcacagacaccccccagggccggctgtactctgaccactatggc
ctgtaccatacaagcccctcgctgggtggcctgacccggcccgtggtcctgtggagtcag
caggacgtctgcaagtggctcaagaagcactgtccccacaactacctcgtctacgtggag
gccttctcccagcatgccatcaccggccgggcactgctgcggctgaatgcggagaagctg
cagcggatggggctggcccaggaggcccagaggcaggaggtgctgcagcaggtgctccgc
ctgcaggtgcgtgaggaggggcggagcctgcagctgctcagccaagcttccttcgggaaa
atgtcctag

DBGET integrated database retrieval system