KEGG   Homo sapiens (human): 140706Help
Entry
140706            CDS       T01001                                 

Gene name
CCM2L, C20orf160, dJ310O13.5
Definition
(RefSeq) CCM2 like scaffold protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 140706
NCBI-ProteinID: NP_542192
HGNC: 16153
Ensembl: ENSG00000101331
Vega: OTTHUMG00000032197
Pharos: Q9NUG4(Tdark)
UniProt: Q9NUG4
Position
20q11.21
AA seq 433 aa AA seqDB search
MEYEVKKGKKGFVSPIRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDY
LEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
TWRDNEELILRIPTHEIAAASYLQDDALHLLVLKTGLGVDPVPAGVDASPGGAGRDPGPP
GGAPEKRRVGTAERRHTICSLDWRMGWGGGAAEARAGGGGGGSLERQRAGARASGSWERR
QTFSGSWERRHGGGGGGGGAGKPGGSWERRQAGSGGGGSWERRHPGPNPLDPQDPSPDAY
CNLVILAVANRDAAEESCALICQVFQIIYGDQSIECVDRAGYHYTSTPERPWLCSRIMAP
RTPLKHVTAARPHLLSMAPTAAAATTAVWAWSSYRITWSRCGVSWGPSRSSSLRCCCGST
GWGCPSRTIAQAC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgaagtcaagaaagggaagaagggctttgtatcccccatccgaaggctggtg
ttccccaaggccgggcgccgggcagcctgtaggagcagcgtgagccgccggcccctgcac
tcgatgcccctttatccccccgactacctcatcgacccccagattctgctgtgtgactac
ctggagaaagaggtcaagttcctgggccaccttacctgggtgacttcctcactgaacccc
tccagtcgggacgagctcctgcagctgctagacaccgccaggcagctgaaggagctgccg
ctgaagaccacggcggagcaggacagcatcctgagcctgtctgcccgctgcctgctgctc
acctggcgcgacaatgaagagctcattctgcgaatccctacgcacgagatcgccgccgcc
tcctacctgcaggacgacgcgctgcacctgctagtgctcaagaccggtctgggtgtggac
ccggtgccggccggcgtggatgccagcccaggcggcgcaggacgcgaccccggcccgcca
ggcggggcgcccgagaagcggcgggtgggcaccgcggagcggcgccacaccatctgcagc
ctggactggcggatggggtggggtgggggcgccgcggaggcccgggccgggggaggcggc
ggcggcagcttggagcgccagcgcgccggggcgcgggcgtcgggcagctgggagcgacgg
cagacgttcagcggcagctgggagcggcggcacggaggcggcggcggcggcggcggcgcg
ggaaagccgggcggtagctgggagcggaggcaggcgggcagcggcgggggaggcagctgg
gagcggcgccaccccggccccaacccgctcgacccgcaggaccccagccccgacgcctac
tgcaacctggtcatcctggctgtagccaacagggacgctgcagaggagtcctgcgcactc
atctgtcaggtcttccagatcatctacggggaccagagtattgagtgtgtggaccgggct
ggctaccactacacatccacacctgaacggccatggctctgcagccgcataatggctccc
aggacacctttgaagcatgttacagcggcacgtccacaccttctttccatggctcccact
gcagcggcagcgaccacagcagtctgggcttggagcagttacaggattacatggtcacgt
tgcggagtaagctggggcccctcgagatccagcagtttgcgatgctgctgcgggagtacc
ggctggggctgcccatccaggactattgcacaggcctgctga

DBGET integrated database retrieval system