KEGG   Homo sapiens (human): 140707Help
Entry
140707            CDS       T01001                                 

Gene name
BRI3BP, BNAS1, HCCR-1, HCCR-2, HCCRBP-1, HCCRBP-3, KG19
Definition
(RefSeq) BRI3 binding protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BRI3BP CLZ GSH_synth_ATP Sugarporin_N MgtE
Motif
Other DBs
NCBI-GeneID: 140707
NCBI-ProteinID: NP_542193
OMIM: 615627
HGNC: 14251
Ensembl: ENSG00000184992
Vega: OTTHUMG00000168548
Pharos: Q8WY22(Tbio)
UniProt: Q8WY22
Position
12q24.31
AA seq 251 aa AA seqDB search
MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSL
FGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS
SPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGE
PENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR
VLESLDRSKDK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgcgcgcctcaggcgggcccctggcccgggccgggctcctgctgctgctgctg
ctgctgctgctgctcgggctgctggccccgggcgcgcagggggcgcggggccgcggcggc
gcggagaagaacagctaccgccgcacggtcaacaccttctcccagagcgtcagcagcctg
ttcggcgaggacaacgtgcgcgccgctcagaagttcttggccaggctgactgagagattt
gtgctgggagtggatatgttcgtggagacactgtggaaagtctggaccgagctcttggat
gttcttggacttgacgtctccaacctgtcccagtatttcagcccagcctcggtgtccagc
agcccggcccgcgcgctcctgctggtcggcgtcgtcctcctggcctactggttcttgtcc
ctgaccctgggcttcactttcagcgtcctgcacgtggtgttcggccgcttcttctggatc
gtgcgggtcgtcctgttttccatgtcctgcgtgtacatcctgcacaagtacgagggcgag
ccggagaacgcggtgctgccgctgtgcttcgtggtggccgtctacttcatgaccgggccc
atgggcttctactggcgaagcagtcccagcggccccagcaaccccagcaaccccagcgtg
gaggagaagctggagcacctggagaagcaggtcagactgctcaacatccgtctcaaccgg
gtgctcgagagcctggaccgctccaaggacaagtga

DBGET integrated database retrieval system