KEGG   Homo sapiens (human): 140735
Entry
140735            CDS       T01001                                 

Gene name
DYNLL2, DNCL1B, Dlc2, RSPH22
Definition
(RefSeq) dynein light chain LC8-type 2
  KO
K10418  dynein light chain LC8-type
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    140735 (DYNLL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    140735 (DYNLL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    140735 (DYNLL2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     140735 (DYNLL2)
SSDB
Motif
Pfam: Dynein_light Nop Ectatomin
Other DBs
NCBI-GeneID: 140735
NCBI-ProteinID: NP_542408
OMIM: 608942
HGNC: 24596
Ensembl: ENSG00000264364
Vega: OTTHUMG00000178783
Pharos: Q96FJ2(Tdark)
UniProt: Q96FJ2
Structure
PDB: 
2XQQ 4D07 3P8M

Position
17q22
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat
gccgttgactgcgccacgcaggccatggagaagtacaatatagagaaggacattgctgcc
tatatcaagaaggaatttgacaagaaatataaccctacctggcattgtatcgtgggccga
aattttggcagctacgtcacacacgagacaaagcacttcatctatttttacttgggtcaa
gttgcaatcctcctcttcaagtcaggctag

DBGET integrated database retrieval system