KEGG   Homo sapiens (human): 140809Help
Entry
140809            CDS       T01001                                 

Gene name
SRXN1, C20orf139, Npn3, SRX, SRX1
Definition
(RefSeq) sulfiredoxin 1
  KO
K12260  sulfiredoxin [EC:1.8.98.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    140809 (SRXN1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, physiological acceptors
    1.8.98.2  sulfiredoxin
     140809 (SRXN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ParBc
Motif
Other DBs
NCBI-GeneID: 140809
NCBI-ProteinID: NP_542763
OMIM: 617583
HGNC: 16132
Ensembl: ENSG00000271303
Vega: OTTHUMG00000031644
Pharos: Q9BYN0(Tbio)
UniProt: Q9BYN0
Structure
PDB: 

Position
20p13
AA seq 137 aa AA seqDB search
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPA
KVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS
TLSDLRVYLGASTPDLQ
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgtgcaggaggaacgctgggcagggccggcgcgggtcggggggcgcccgag
gggcccgggccgagcggcggcgcgcagggcggcagcatccactcgggccgcatcgccgcg
gtgcacaacgtgccgctgagcgtgctcatccggccgctgccgtccgtgttggaccccgcc
aaggtgcagagcctcgtggacacgatccgggaggacccagacagcgtgccccccatcgat
gtcctctggatcaaaggggcccagggaggtgactacttctactcctttgggggctgccac
cgctacgcggcctaccagcaactgcagcgagagaccatccccgccaagcttgtccagtcc
actctctcagacctaagggtgtacctgggagcatccacaccagacttgcagtag

DBGET integrated database retrieval system