KEGG   Homo sapiens (human): 140823
Entry
140823            CDS       T01001                                 

Gene name
ROMO1, C20orf52, MTGM, MTGMP, bA353C18.2
Definition
(RefSeq) reactive oxygen species modulator 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Romo1 Tim17 TCRP1
Other DBs
NCBI-GeneID: 140823
NCBI-ProteinID: NP_542786
OMIM: 618894
HGNC: 16185
Ensembl: ENSG00000125995
Vega: OTTHUMG00000032360
Pharos: P60602(Tbio)
UniProt: P60602
Position
20q11.22
AA seq 79 aa
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt   +upstreamnt  +downstreamnt
atgccggtggccgtgggtccctacggacagtcccagccaagctgcttcgaccgtgtcaaa
atgggcttcgtgatgggttgcgccgtgggcatggcggccggggcgctcttcggcaccttt
tcctgtctcaggatcggaatgcggggtcgagagctgatgggcggcattgggaaaaccatg
atgcagagtggcggcacctttggcacattcatggccattgggatgggcatccgatgctaa

DBGET integrated database retrieval system