KEGG   Homo sapiens (human): 140838
Entry
140838            CDS       T01001                                 
Symbol
NANP, C20orf147, HDHD4, dJ694B14.3
Name
(RefSeq) N-acetylneuraminic acid phosphatase
  KO
K01097  N-acylneuraminate-9-phosphatase [EC:3.1.3.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
hsa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    140838 (NANP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    140838 (NANP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.29  N-acylneuraminate-9-phosphatase
     140838 (NANP)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   140838 (NANP)
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PcrB
Other DBs
NCBI-GeneID: 140838
NCBI-ProteinID: NP_689880
OMIM: 610763
HGNC: 16140
Ensembl: ENSG00000170191
UniProt: Q8TBE9
Position
20:complement(25612935..25624014)
AA seq 248 aa
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKEC
FHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTE
LRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQ
PGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSI
DCKVSMST
NT seq 747 nt   +upstreamnt  +downstreamnt
atggggctgagccgcgtgcgggcggttttctttgacttggacaacactctcatcgacacg
gccggggcgagcaggagaggcatgttggaggtgataaaactcttacaatcaaaataccat
tataaagaagaggctgaaatcatctgtgataaagttcaagttaaactcagcaaggaatgt
tttcatccttacaatacatgcattactgatttaaggacttcacattgggaagaagcaatc
caggaaacaaaaggtggtgcagccaatagaaaattggctgaagaatgttatttcctttgg
aaatctacacgtttacagcatatgacactagcagaagacgtcaaagccatgcttactgaa
cttcgaaaggaggtccgcctacttctattaacgaatggggacagacagacccagagggag
aagattgaggcttgtgcctgtcagtcctattttgacgctgttgttgtaggtggagagcag
agagaggagaaaccagcaccgtccatattttattactgctgcaatcttctcggagtacaa
cctggggactgtgtgatggtcggtgacacattagaaaccgacatccaaggaggcctcaat
gcaggattgaaagcaacagtctggatcaataaaaatggaatagtgccactgaagtcctcc
ccagttccgcattacatggtttcttctgtgctagagttacctgctctcttacaaagtata
gactgcaaagtcagtatgtccacttaa

DBGET integrated database retrieval system