KEGG   Homo sapiens (human): 140850Help
Entry
140850            CDS       T01001                                 

Gene name
DEFB127, C20orf73, DEF-27, DEFB-27, DEFB27, bA530N10.2, hBD-27
Definition
(RefSeq) defensin beta 127
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2 AIM5 Defensin_RK-1
Motif
Other DBs
NCBI-GeneID: 140850
NCBI-ProteinID: NP_620713
HGNC: 16206
Ensembl: ENSG00000088782
Vega: OTTHUMG00000031617
Pharos: Q9H1M4(Tdark)
UniProt: Q9H1M4
Position
20p13
AA seq 99 aa AA seqDB search
MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKEL
EACKKITKPPRPKPATLALTLQDYVTIIENFPSLKTQST
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggggctcttcatgatcattgcaattctgctgttccagaaacccacagtaaccgaacaa
cttaagaagtgctggaataactatgtacaaggacattgcaggaaaatctgcagagtaaat
gaagtgcctgaggcactatgtgaaaatgggagatactgttgcctcaatatcaaggaactg
gaagcatgtaaaaaaattacaaagccacctcgtccaaagccagcaacacttgcactgact
cttcaagactatgttacaataatagaaaatttcccaagcctgaagacacagtctacataa

DBGET integrated database retrieval system