KEGG   Homo sapiens (human): 140885Help
Entry
140885            CDS       T01001                                 

Gene name
SIRPA, BIT, CD172A, MFR, MYD-1, P84, PTPNS1, SHPS1, SIRP
Definition
(RefSeq) signal regulatory protein alpha
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    140885 (SIRPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    140885 (SIRPA)
   04090 CD molecules [BR:hsa04090]
    140885 (SIRPA)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  SIRP family
   140885 (SIRPA)
CD molecules [BR:hsa04090]
 Proteins
  140885 (SIRPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set ig Ig_2 I-set SIT DUF4448 G6B Eryth_link_C TMEM154 Shisa Mid2 TMEM132D_C Orf78 Syndecan DUF4577 DUF2892
Motif
Other DBs
NCBI-GeneID: 140885
NCBI-ProteinID: NP_001035111
OMIM: 602461
HGNC: 9662
Ensembl: ENSG00000198053
Vega: OTTHUMG00000031682
Pharos: P78324(Tbio)
UniProt: P78324
Structure
PDB: 

Position
20p13
AA seq 504 aa AA seqDB search
MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSL
IPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI
TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL
RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS
TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT
AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI
TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNR
TPKQPAPKPEPSFSEYASVQVPRK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccggcccggcccccggccgcctcgggccgctgctctgcctgctgctcgcc
gcgtcctgcgcctggtcaggagtggcgggtgaggaggagctgcaggtgattcagcctgac
aagtccgtgttggttgcagctggagagacagccactctgcgctgcactgcgacctctctg
atccctgtggggcccatccagtggttcagaggagctggaccaggccgggaattaatctac
aatcaaaaagaaggccacttcccccgggtaacaactgtttcagacctcacaaagagaaac
aacatggacttttccatccgcatcggtaacatcaccccagcagatgccggcacctactac
tgtgtgaagttccggaaagggagccccgatgacgtggagtttaagtctggagcaggcact
gagctgtctgtgcgcgccaaaccctctgcccccgtggtatcgggccctgcggcgagggcc
acacctcagcacacagtgagcttcacctgcgagtcccacggcttctcacccagagacatc
accctgaaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggacccc
gtaggagagagcgtgtcctacagcatccacagcacagccaaggtggtgctgacccgcgag
gacgttcactctcaagtcatctgcgaggtggcccacgtcaccttgcagggggaccctctt
cgtgggactgccaacttgtctgagaccatccgagttccacccaccttggaggttactcaa
cagcccgtgagggcagagaaccaggtgaatgtcacctgccaggtgaggaagttctacccc
cagagactacagctgacctggttggagaatggaaacgtgtcccggacagaaacggcctca
accgttacagagaacaaggatggtacctacaactggatgagctggctcctggtgaatgta
tctgcccacagggatgatgtgaagctcacctgccaggtggagcatgacgggcagccagcg
gtcagcaaaagccatgacctgaaggtctcagcccacccgaaggagcagggctcaaatacc
gccgctgagaacactggatctaatgaacggaacatctatattgtggtgggtgtggtgtgc
accttgctggtggccctactgatggcggccctctacctcgtccgaatcagacagaagaaa
gcccagggctccacttcttctacaaggttgcatgagcccgagaagaatgccagagaaata
acacaggacacaaatgatatcacatatgcagacctgaacctgcccaaggggaagaagcct
gctccccaggctgcggagcccaacaaccacacggagtatgccagcattcagaccagcccg
cagcccgcgtcggaggacaccctcacctatgctgacctggacatggtccacctcaaccgg
acccccaagcagccggcccccaagcctgagccgtccttctcagagtacgccagcgtccag
gtcccgaggaagtga

DBGET integrated database retrieval system