KEGG   Homo sapiens (human): 140947Help
Entry
140947            CDS       T01001                                 

Gene name
DCANP1, C5orf20, DCNP1
Definition
(RefSeq) dendritic cell associated nuclear protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 140947
NCBI-ProteinID: NP_570900
OMIM: 609710
HGNC: 24459
Ensembl: ENSG00000251380
Vega: OTTHUMG00000163308
Pharos: Q8TF63(Tbio)
UniProt: Q8TF63
Position
5q31.1
AA seq 244 aa AA seqDB search
MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPL
QGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKT
GQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKS
SDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAA
HVPE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcattacggagcagcaacccacatacagaactcgagaagccacggcctggagactgta
cctggacaccaaagactggagagaggagctggtggggaaaccccagagttcccagggtgc
cactccccagctccaccagagaactttgggaatgagctgctgcccctgagtgcccctctc
cagggcctcagtgagggtctctaccctccagggaggaacaaaaccttgccagctggggtc
ctgcgagagggggcagttcaattcctccacaggggactctgcaactccaatctttcgagt
gaagcatctgcgaggccctcagggacccaggatgaactgcatagcagcagaaggaagaca
ggccagaccaggcgggagggagcccggaaacatctggtttgtagtttcagactctacccg
ttcacagttcacacagtctcaccgggaaactcacaccttgccctgtaccaagtttttaag
gcagttaagctctgcccatccgagacttcatttttcttgagtagaaaatcactgaaatca
tcagatccatggcacccaccttcactttctcctaacagctggaaccgtcaggctggcttc
agggcctggtcttcgcacttgatatcactatccctcacctgctcagacagccagagcagg
cgggtgagttcctcccaacaacctccactgcattctctcagctcccaccgcagggcagcc
cacgtgcctgagtga

DBGET integrated database retrieval system