KEGG   Homo sapiens (human): 142Help
Entry
142               CDS       T01001                                 

Gene name
PARP1, ADPRT, ADPRT_1, ADPRT1, ARTD1, PARP, PARP-1, PPOL, pADPRT-1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
Module
hsa_M00296  BER complex
Drug target
Iniparib: D09913
Niraparib: D10140
Olaparib: D09730
Rucaparib (DG01864): D10079 D10157 D10982
Talazoparib (DG01865): D10732 D10733
Veliparib: D09692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    142 (PARP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    142 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    142 (PARP1)
   04217 Necroptosis
    142 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    142 (PARP1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    142 (PARP1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    142 (PARP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     142 (PARP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     142 (PARP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    142 (PARP1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     142 (PARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 142
NCBI-ProteinID: NP_001609
OMIM: 173870
HGNC: 270
Ensembl: ENSG00000143799
Vega: OTTHUMG00000037556
Pharos: P09874(Tclin)
UniProt: P09874 A0A024R3T8
Structure
PDB: 

Position
1q42.12
AA seq 1014 aa AA seqDB search
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctatcgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcaccctgacgttgaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagactctgggtgactttgcagcagagtatgccaagtcc
aacagaagtacgtgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatggtggacccggagaagccacagctaggcatgattgaccgctggtaccatcca
ggctgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctacagaggataaagaagccctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaaaggcgatgaggtggatggagtggatgaagtggcg
aagaagaaatctaaaaaagaaaaagacaaggatagtaagcttgaaaaagccctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagctgatggcatggtgttcggtgccctccttccctgcgaggaatgctcgggt
cagctggtcttcaagagcgatgcctattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaaacaggaccgtatattccccccagaa
accagcgcctccgtggcggccacgcctccgccctccacagcctcggctcctgctgctgtg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactctcgggaag
ctgtcccggaacaaggatgaagtgaaggccatgattgagaaactcggggggaagttgacg
gggacggccaacaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcaggagttgttcttagcgcacatcttgtcccct
tggggggcagaggtgaaggcagagcctgttgaagttgtggccccaagagggaagtcaggg
gctgcgctctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccacccttggcctggtg
gacatcgttaaaggaaccaactcctactacaagctgcagcttctggaggacgacaaggaa
aacaggtattggatattcaggtcctggggccgtgtgggtacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacgaagtatcccaaaaagttctacccc
ctggagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagatgatctttgatgtggaa
agtatgaagaaagccatggtggagtatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcatactccatcctcagtgaggtccagcaggcggtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacaatgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggatcccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgttacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgctgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcgcccgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcctg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgatccttcagct
aacattagtctggatggtgtagacgttcctcttgggaccgggatttcatctggtgtgaat
gacacctctctactatataacgagtacattgtctatgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

DBGET integrated database retrieval system