KEGG   Homo sapiens (human): 142678Help
Entry
142678            CDS       T01001                                 

Gene name
MIB2, ZZANK1, ZZZ5
Definition
(RefSeq) mindbomb E3 ubiquitin protein ligase 2
  KO
K10645  E3 ubiquitin-protein ligase mind-bomb [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    142678 (MIB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     142678 (MIB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    142678 (MIB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIB_HERC2 SH3_15 Ank_2 Ank_5 Ank_4 Ank Ank_3 zf-C3HC4_3 ZZ zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 142678
NCBI-ProteinID: NP_543151
OMIM: 611141
HGNC: 30577
Ensembl: ENSG00000197530
Vega: OTTHUMG00000074647
Pharos: Q96AX9(Tbio)
UniProt: Q96AX9
Position
1p36.33
AA seq 1013 aa AA seqDB search
MGWKPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAARPTMDPSAHRSRAAPPNMD
PDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRT
NYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHN
KHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPG
RVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGK
PAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDR
GDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALG
RVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDK
LRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIR
LLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRG
FLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFT
LLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVN
VRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA
GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRV
LKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLV
LFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRY
RQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgggttggaagcccagcgaggctagaggccagtcccaaagtttccaggcatcagggctg
cagcccaggagcctcaaggcggcccggcgggcgactggacggccggacaggtcccgagca
gcccggcccaccatggacccctctgcccacaggtcccgagcagccccgcccaacatggac
ccagacccccaggcgggcgtgcaggtgggcatgcgggtggtgcgcggcgtggactggaag
tggggccagcaggacggcggcgagggcggcgtgggcacggtggtggagcttggccgccac
ggcagcccctcgacacccgaccgcacagtggtcgtgcagtgggaccagggcacgcgcacc
aactaccgcgccggctaccagggcgcgcacgacctgctgctgtacgacaacgcccagatc
ggcgtccggcaccccaacatcatctgtgactgctgcaagaagcacgggctgcgggggatg
cgctggaagtgccgtgtgtgcctggactacgacctctgcacgcagtgctacatgcacaac
aagcatgagctcgcccacgccttcgaccgctacgagaccgctcactcgcgccctgtcaca
ctgagtccccgccagggcctcccgaggatcccactaaggggcatcttccagggagcgaag
gtggtgcgaggccccgactgggagtggggctcacaggatggaggggaagggaaaccgggc
cgtgtggtggacatccgtggctgggatgtggagacaggccggagtgtggccagcgtgacg
tgggctgatggtaccaccaatgtgtaccgtgtgggccacaagggcaaggtggacctcaag
tgtgtgggcgaggcagcgggcggcttctactacaaggaccacctcccaaggctcggcaag
ccggcggagctgcagcgcagggtgagtgctgacagccagcccttccagcacggggacaag
gtcaagtgtctgctggacactgatgtcctgcgggagatgcaggaaggccacggcggctgg
aaccccaggatggcggagtttatcggacagacgggcaccgtgcatcgtatcacggaccgc
ggggacgtgcgcgtgcagttcaaccacgagacgcgctggaccttccaccccggggcgctc
accaagcaccactccttctgggtgggcgacgtggtccgggtcatcggcgaccttgacaca
gtgaagcggctgcaggctgggcatggcgagtggacggacgacatggcccctgccctgggc
cgcgtcgggaaggtggtgaaagtgtttggagacgggaacctgcgtgtagcagtcgctggt
cagcggtggaccttcagcccctcctgcctggtggcctaccggcccgaggaggatgccaac
ctggacgtggccgagcgcgcccgggagaacaaaagctcactgagcgtggccctggacaag
cttcgggcccagaagagtgacccagagcacccgggaaggctggtggtggaggtggcgctg
ggtaacgcagcccgggctctggacctgctgcggaggcgcccagagcaggtggacaccaag
aaccaaggcaggaccgctctgcaagtggctgcctacctgggccaggtggagttgatacgg
ctgctgctacaagccagggcgggcgtggacctgccggacgacgagggcaacacggcactg
cactacgcggccctggggaaccagcccgaggccaccagggtgctcctgagtgctgggtgc
cgggcggacgccatcaacagcacccagagcacagcactgcacgtggccgtgcagaggggc
ttcctggaggtggtgcgggccctgtgtgagcgcggctgtgacgtcaacctgcccgacgcc
cactcggacacgcccctgcactccgccatctcggcgggcactggagccagcggcattgtc
gaggtcctcacggaggtgccaaacatcgatgttaccgccaccaacagccagggtttcacc
ctgctgcaccatgcctccctcaagggtcacgcgctagctgtgagaaagattctggctcgg
gcgcggcagctggtggacgccaagaaggaggacggcttcacggcgctgcatctggctgcc
ctcaacaaccaccgcgaggtggcccagatcctcatccgggagggccgctgtgacgtgaac
gtgcgcaaccggaagctgcagtccccgctgcatctcgccgtgcaacaggcccacgtgggg
ctggtgccgctactggtggacgctgggtgcagtgtcaacgccgaggacgaggagggggac
acagccctgcacgtggcgctgcagcgtcatcagctgctgcccctggtggctgatggggcc
gggggggacccagggcccttgcagctgctgtccaggctacaggcctcgggcctccccggc
agcgcggagctgacggtgggcgcggcggtcgcctgcttcctggcgctggagggcgccgac
gtgagctacaccaaccaccgcggtcggagcccgctggacctggccgccgagggtcgcgtg
ctcaaggcccttcagggctgcgcccagcgcttccgggagcggcaggcgggcgggggcgcg
gccccgggccccaggcaaacgctcgggacccccaacaccgtgacgaacctgcacgtgggc
gccgcgccggggcccgaggccgctgagtgcctggtgtgctccgagctggcgctgctggtg
ctgttctcgccgtgccagcaccgcaccgtgtgtgaggagtgcgcgcgcaggatgaagaag
tgcatcaggtgccaggtggtcgtcagcaagaaactgcgcccagacggctctgaggtggcg
agcgccgcccccgcccccggcccgccgcgccagctggtggaggagctgcagagccgctac
cggcagatggaggaacgcatcacctgccccatctgcatcgacagccacatccgcctcgtg
ttccagtgcggccacggcgcatgcgccccctgcggctccgcgctcagcgcctgccccatc
tgccgccagcccatccgcgaccgcatccagatcttcgtgtga

DBGET integrated database retrieval system