KEGG   Homo sapiens (human): 142680Help
Entry
142680            CDS       T01001                                 

Gene name
SLC34A3, HHRH, NPTIIc
Definition
(RefSeq) solute carrier family 34 member 3
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H00214  Hypophosphatemic rickets
H02138  Hereditary hypophophatemic rickets with hypercalciuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    142680 (SLC34A3)
  09154 Digestive system
   04978 Mineral absorption
    142680 (SLC34A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    142680 (SLC34A3)
   04147 Exosome [BR:hsa04147]
    142680 (SLC34A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   142680 (SLC34A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   142680 (SLC34A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Pi_cotrans
Motif
Other DBs
NCBI-GeneID: 142680
NCBI-ProteinID: NP_001170787
OMIM: 609826
HGNC: 20305
Ensembl: ENSG00000198569
Vega: OTTHUMG00000131780
Pharos: Q8N130(Tbio)
UniProt: Q8N130
Position
9q34.3
AA seq 599 aa AA seqDB search
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMELAAVGGPLVGLVLLVILVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgccgagttcccttcccggcagccaggtcccccaccccactctggacgcggttgaccta
gtggaaaagactctgaggaatgaagggacctccagttctgctccagtcttggaggaaggg
gacacagacccctggaccctccctcagctgaaggacacaagccagccctggaaagagctc
cgcgtggccggcaggctgcgccgcgtggccggcagcgtcctcaaggcctgcgggctcctc
ggcagcctgtacttcttcatctgctctctggacgtcctcagctccgccttccagctgctg
ggcagcaaagtggccggagacatcttcaaggacaacgtggtgctgtccaaccctgtggct
ggactggtcattggcgtgctggtcacagccctggtgcagagttccagcacgtcctcctcc
atcgtggtcagcatggtggctgctaagctgctgactgtccgggtgtctgtgcccatcatc
atgggtgtcaacgtaggcacatccatcaccagcaccctggtctcaatggcgcagtcaggg
gaccgggatgaatttcagagggctttcagcggctcggcggtgcacgggatcttcaactgg
ctcacagtgctggtcctgctgccactggagagcgccacggccctgctggagaggctaagt
gagctagccctgggtgccgccagcctgacacccagggcgcaggcgcccgacatcctcaag
gtgctgacgaagccgctcacacacctcatcgtgcagttggactccgacatgatcatgagc
agtgccacaggcaacgccactaacagcagtctcattaagcactggtgcggcaccacgggg
cagccgacccaggagaacagcagctgtggcgccttcggcccgtgcacagagaagaacagc
acagccccggcggacaggctgccctgccgccacctgtttgcgggcacggagctcacggac
ctggccgtgggctgcatcctgctggccggctccctgctggtgctctgcggctgcctggtc
ctcatagtcaagctgctcaactctgtgctgcgcggccgcgtggcccaggtcgtgaggaca
gtcatcaatgcggacttccccttcccgctgggctggctcggcggctacctggccgtcctc
gcgggcgccggcctgaccttcgcactgcagagcagcagcgtcttcacggcggccgtcgtg
cccctcatgggggtcggggtgatcagtctggaccgggcgtaccccctcttactgggctcc
aacatcggcaccactaccacagccctgctggctgccctggccagccccgcagacaggatg
ctcagcgccctgcaggtcgccctcatccacttcttcttcaacctggccggcatcctgctg
tggtacctggtgcctgcactgcggctgcccatcccgctggccaggcacttcggggtggtg
accgcccgttaccgctgggtggctggggtctacctgctgctcggattcctgctgctgccc
ctggcggccttcgggctctccctggcagggggcatggagctggccgctgtcgggggtccc
ctggtggggctggtgctcctcgtcatcctggttactgtcctgcagcggcgccggccggcc
tggctgcctgtccgcctgcgctcctgggcctggctccccgtctggctccattctctggag
ccctgggaccgcctggtgacccgctgctgcccctgcaacgtctgcagccccccgaaggcc
accaccaaagaggcctactgctacgagaaccctgagatcttggcctcccagcagttgtga

DBGET integrated database retrieval system