KEGG   Homo sapiens (human): 142680Help
Entry
142680            CDS       T01001                                 

Gene name
SLC34A3, HHRH, NPTIIc
Definition
(RefSeq) solute carrier family 34 member 3
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00214  Hypophosphatemic rickets
H02138  Hereditary hypophophatemic rickets with hypercalciuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    142680 (SLC34A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    142680 (SLC34A3)
   04147 Exosome [BR:hsa04147]
    142680 (SLC34A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   142680 (SLC34A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   142680 (SLC34A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Pi_cotrans
Motif
Other DBs
NCBI-GeneID: 142680
NCBI-ProteinID: NP_001170787
OMIM: 609826
HGNC: 20305
Ensembl: ENSG00000198569
Vega: OTTHUMG00000131780
Pharos: Q8N130(Tbio)
UniProt: Q8N130
Position
9q34.3
AA seq 599 aa AA seqDB search
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMVLAAVGGPLVGLVLLVILVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgccgagttcccttcccggcagccaggtcccccaccccactctggacgcggttgaccta
gtggaaaagactctgaggaatgaagggacctccagttctgctccagtcttggaggaaggg
gacacagacccctggaccctccctcagctgaaggacacaagccagccctggaaagagctc
cgcgtggccggcaggctgcgccgcgtggccggcagcgtcctcaaggcctgcgggctcctc
ggcagcctgtacttcttcatctgctctctggacgtcctcagctccgccttccagctgctg
ggcagcaaagtggccggagacatcttcaaggacaacgtggtgctgtccaaccctgtggct
ggactggtcattggcgtgctggtcacagccctggtgcagagttccagcacgtcctcctcc
atcgtggtcagcatggtggctgctaagctgctgactgtccgggtgtctgtgcccatcatc
atgggtgtcaacgtaggcacatccatcaccagcaccctggtctcaatggcgcagtcaggg
gaccgggatgaatttcagagggctttcagcggctcggcggtgcacgggatcttcaactgg
ctcacagtgctggtcctgctgccactggagagcgccacggccctgctggagaggctaagt
gagctagccctgggtgccgccagcctgacacccagggcgcaggcgcccgacatcctcaag
gtgctgacgaagccgctcacacacctcatcgtgcagttggactccgacatgatcatgagc
agtgccacaggcaacgccactaacagcagtctcattaagcactggtgcggcaccacgggg
cagccgacccaggagaacagcagctgtggcgccttcggcccgtgcacagagaagaacagc
acagccccggcggacaggctgccctgccgccacctgtttgcgggcacggagctcacggac
ctggccgtgggctgcatcctgctggccggctccctgctggtgctctgcggctgcctggtc
ctcatagtcaagctgctcaactctgtgctgcgcggccgcgtggcccaggtcgtgaggaca
gtcatcaatgcggacttccccttcccgctgggctggctcggcggctacctggccgtcctc
gcgggcgccggcctgaccttcgcactgcagagcagcagcgtcttcacggcggccgtcgtg
cccctcatgggggtcggggtgatcagtctggaccgggcgtaccccctcttactgggctcc
aacatcggcaccactaccacagccctgctggctgccctggccagccccgcagacaggatg
ctcagcgccctgcaggtcgccctcatccacttcttcttcaacctggccggcatcctgctg
tggtacctggtgcctgcactgcggctgcccatcccgctggccaggcacttcggggtggtg
accgcccgttaccgctgggtggctggggtctacctgctgctcggattcctgctgctgccc
ctggcggccttcgggctctccctggcagggggcatggtgctggccgctgtcgggggtccc
ctggtggggctggtgctcctcgtcatcctggttactgtcctgcagcggcgccggccggcc
tggctgcctgtccgcctgcgctcctgggcctggctccccgtctggctccattctctggag
ccctgggaccgcctggtgacccgctgctgcccctgcaacgtctgcagccccccgaaggcc
accaccaaagaggcctactgctacgagaaccctgagatcttggcctcccagcagttgtga

DBGET integrated database retrieval system