KEGG   Homo sapiens (human): 142684
Entry
142684            CDS       T01001                                 
Symbol
RAB40A, RAR2, RAR2A
Name
(RefSeq) RAB40A, member RAS oncogene family
  KO
K07928  Ras-related protein Rab-40
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    142684 (RAB40A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    142684 (RAB40A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     142684 (RAB40A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab40
    142684 (RAB40A)
SSDB
Motif
Pfam: Ras Roc Arf SOCS_box MMR_HSR1
Other DBs
NCBI-GeneID: 142684
NCBI-ProteinID: NP_543155
OMIM: 301065
HGNC: 18283
Ensembl: ENSG00000172476
Pharos: Q8WXH6(Tdark)
UniProt: Q8WXH6
Position
X:complement(103493266..103519489)
AA seq 277 aa
MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcgccccgggcagccccgaccaggcctatgacttcctgctcaagttcctgctggtg
ggcgacagggacgtaggcaagagtgagatcctggagagcctgcaggatggtgcagctgag
tccccgtacagccatctcggggggatcgactacaagacgaccaccatcctgctggacggc
cagcgggtgaagctgaagctctgggatacgtcggggcagggaagattttgtaccatattc
cgctcctactctcgtggtgcacaaggagtgatcctggtctacgacattgcaaaccgctgg
tctttcgagggtatggatcgatggattaagaagattgaggaacatgcccctggtgtccct
aaaatcctggtggggaatcgcctacatctggcattcaagaggcaggtgcccagggagcag
gcccaggcctacgccgagcgcctgggtgtgaccttctttgaggtcagccctctgtgcaat
ttcaacatcatagagtctttcacggagctggccaggatagtgctgctgcggcacaggatg
aattggctcgggaggccgagcaaggtactgagcttgcaagacctctgctgccgcaccatc
gtgtcctgcacacctgtgcatctggtggacaagctcccgctccccagtaccttaagaagc
cacctcaagtccttctccatggctaagggcctgaatgccaggatgatgcgaggcctctcc
tactccctcaccaccagctccactcacaagagcagcctctgcaaagtggagatcgtctgc
ccaccccagagcccacccaaaaactgcaccagaaacagctgcaaaatttcttaa

DBGET integrated database retrieval system