KEGG   Homo sapiens (human): 142689Help
Entry
142689            CDS       T01001                                 

Gene name
ASB12
Definition
(RefSeq) ankyrin repeat and SOCS box containing 12
  KO
K10334  ankyrin repeat and SOCS box protein 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    142689 (ASB12)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     142689 (ASB12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank_5 Ank_4 Ank SOCS_box
Motif
Other DBs
NCBI-GeneID: 142689
NCBI-ProteinID: NP_569059
OMIM: 300891
HGNC: 19763
Ensembl: ENSG00000198881
Vega: OTTHUMG00000021705
Pharos: Q8WXK4(Tdark)
UniProt: Q8WXK4
Position
Xq11.2
AA seq 318 aa AA seqDB search
MRIVLQLAKMNLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERY
KRFINSRSGWGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLD
CVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELLDHGAEANVKAKLPVWASNIAS
CSGPLYLAAVYGHLDCFRLLLLHGADPDYNCTDQGLLARVPRPRTLLEICLHHNCEPEYI
QLLIDFGANIYLPSLSLDLTSQDDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQA
INQLDIPPMLISYLKHQL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagttctccaattagccaagatgaacctcatggacatcaccaagatcttctcc
ctcctgcagcccgacaaggaggaggaggacactgacacagaggagaagcaggctctcaat
caagcagtgtatgacaacgactcctatactttggaccagcttttgcgccaggagcgttac
aaacgtttcatcaacagcaggagtggctggggtgttcctgggacacccttgcgcttggct
gcttcttatggccacttgagctgtttgcaagtcctcttagcccatggtgctgatgttgac
agcttggatgtcaaggcacagacgccacttttcactgctgtcagtcatggccatctggac
tgtgtacgtgtgcttttggaagctggtgcctctcctggtggtagcatctacaacaactgt
tctcccgtgctcacagctgcccgtgatggtgctgttgctatcctgcaggagctcctagac
catggtgcagaggccaacgtcaaagctaaactaccagtctgggcatcaaacatagcttca
tgttctggccccctctatttggccgcagtctacgggcacctggactgtttccgcctgctt
ttgctccacggggcagaccctgactacaactgcactgaccagggcctattggctcgtgtc
ccaagaccccgcaccctccttgaaatctgcctccatcataattgtgagccagagtatatc
cagctgttaatcgattttggtgctaatatctaccttccatctctctcccttgacctgacc
tcacaagatgataaaggcattgcattgctgctacaggcccgagccactccacggtcactt
ctatcacaggtccgtttagtcgtccgcagagccttgtgccaggctggccagccacaagcc
atcaaccagctggatattcctcccatgttgattagctacctaaaacaccaactgtaa

DBGET integrated database retrieval system