KEGG   Homo sapiens (human): 142910Help
Entry
142910            CDS       T01001                                 

Gene name
LIPJ, LIPL1, bA425M17.2
Definition
(RefSeq) lipase family member J
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydro_lipase Abhydrolase_1 Hydrolase_4 FSH1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 142910
NCBI-ProteinID: NP_001010939
OMIM: 613921
HGNC: 21773
Ensembl: ENSG00000204022
Vega: OTTHUMG00000018691
Pharos: Q5W064(Tdark)
UniProt: Q5W064
Position
10q23.31
AA seq 366 aa AA seqDB search
MNISQIISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVYLQHGLLTSAS
SWISNLPNNSLGFILADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLP
ASIDFTVKQTRQEEIFYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPL
IRMTYKWKSIVMAFSGNKDFLPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKNLN
MSRLDVYFSHNPAGTSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNM
NVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIID
IIQDNL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaatattagccagattatttcctactggggctaccctgatgaagaatatgatattgta
accgaagatggttatatccttggcctttatagaattccttattggaggacagacaataat
aaaaatctagctcagagggttgttgtatacttgcaacatggtttgcttacatctgccagc
agctggatttccaatcttcccaacaatagtctgggcttcattctggcagatgctggttat
gatgtgtggatgggaaatagcagaggaaatacctggtccaggaaacacttgtacctagaa
acgagttccaaagaattctgggctttcagttttgatgagatggcaaaatatgaccttcca
gcctctattgatttcactgtgaagcaaaccagacaagaggaaatattttatgtaggccat
tcacagggtactactattggtttcataacattttctactatatcaaagatagctgaaaga
atcaaaatattttttgctttagcaccagttttttccacaaagtacttaaaaagtccttta
attagaatgacatacaaatggaagtcaatagtcatggctttttcaggcaacaaagacttc
ttgcctaaaacctcatttaaaaaattcattggttcaaagctgtgtccactacagattttt
gataagatttgcctcaatatcttgtttatgatgtttggatatgacccaaaaaacttaaat
atgagtcgtttggatgtgtatttttcacacaacccagcaggaacatctgttcaaaatatg
cttcattggagtcagcttttaaattctactcatttgaaagcttatgactggggcagtcct
gatctgaacttggttcattataatcagacaacgtctccattatacaacatgacaaacatg
aatgtggcaactgcaatttggaatggtaaaagtgacttgttggctgaccctgaagacgtt
aacattttacattctgaaatcacaaaccacatttattataaaactatttcttactacaat
catatagactctttgtttggattagatgtctatgatcaagtttaccatgaaatcattgat
attatccaagacaatctataa

DBGET integrated database retrieval system