KEGG   Homo sapiens (human): 1432
Entry
1432              CDS       T01001                                 
Symbol
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Name
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04936  Alcoholic liver disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00445  HIV Tat/Nef to TNF-p38 signaling pathway
N00931  Escherichia NleD to TNF-p38 signaling pathway
N01283  Shigella OspF to TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Pamapimod: D08963
Ralimetinib (DG01847): D10658 D10659
Talmapimod: D09386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1432 (MAPK14)
   04015 Rap1 signaling pathway
    1432 (MAPK14)
   04370 VEGF signaling pathway
    1432 (MAPK14)
   04668 TNF signaling pathway
    1432 (MAPK14)
   04068 FoxO signaling pathway
    1432 (MAPK14)
   04071 Sphingolipid signaling pathway
    1432 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    1432 (MAPK14)
   04218 Cellular senescence
    1432 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1432 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    1432 (MAPK14)
   04613 Neutrophil extracellular trap formation
    1432 (MAPK14)
   04620 Toll-like receptor signaling pathway
    1432 (MAPK14)
   04621 NOD-like receptor signaling pathway
    1432 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    1432 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    1432 (MAPK14)
   04660 T cell receptor signaling pathway
    1432 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    1432 (MAPK14)
   04659 Th17 cell differentiation
    1432 (MAPK14)
   04657 IL-17 signaling pathway
    1432 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    1432 (MAPK14)
   04670 Leukocyte transendothelial migration
    1432 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    1432 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    1432 (MAPK14)
   04917 Prolactin signaling pathway
    1432 (MAPK14)
   04926 Relaxin signaling pathway
    1432 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    1432 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1432 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    1432 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    1432 (MAPK14)
   04722 Neurotrophin signaling pathway
    1432 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1432 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1432 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    1432 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    1432 (MAPK14)
   05208 Chemical carcinogenesis - reactive oxygen species
    1432 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1432 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1432 (MAPK14)
   05161 Hepatitis B
    1432 (MAPK14)
   05171 Coronavirus disease - COVID-19
    1432 (MAPK14)
   05163 Human cytomegalovirus infection
    1432 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1432 (MAPK14)
   05169 Epstein-Barr virus infection
    1432 (MAPK14)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1432 (MAPK14)
   05130 Pathogenic Escherichia coli infection
    1432 (MAPK14)
   05132 Salmonella infection
    1432 (MAPK14)
   05131 Shigellosis
    1432 (MAPK14)
   05135 Yersinia infection
    1432 (MAPK14)
   05133 Pertussis
    1432 (MAPK14)
   05152 Tuberculosis
    1432 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    1432 (MAPK14)
   05140 Leishmaniasis
    1432 (MAPK14)
   05142 Chagas disease
    1432 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1432 (MAPK14)
   05020 Prion disease
    1432 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    1432 (MAPK14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1432 (MAPK14)
   05418 Fluid shear stress and atherosclerosis
    1432 (MAPK14)
   05415 Diabetic cardiomyopathy
    1432 (MAPK14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    1432 (MAPK14)
   04932 Non-alcoholic fatty liver disease
    1432 (MAPK14)
   04933 AGE-RAGE signaling pathway in diabetic complications
    1432 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1432 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1432 (MAPK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     1432 (MAPK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   1432 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 1432
NCBI-ProteinID: NP_001306
OMIM: 600289
HGNC: 6876
Ensembl: ENSG00000112062
Pharos: Q16539(Tchem)
UniProt: Q16539 L7RSM2
Structure
Position
6:36027808..36124214
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system