KEGG   Homo sapiens (human): 1432Help
Entry
1432              CDS       T01001                                 

Gene name
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00445  HIV Tat/Nef to TNF-p38 signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Pamapimod: D08963
Ralimetinib (DG01847): D10658 D10659
Talmapimod: D09386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1432 (MAPK14)
   04010 MAPK signaling pathway
    1432 (MAPK14)
   04370 VEGF signaling pathway
    1432 (MAPK14)
   04668 TNF signaling pathway
    1432 (MAPK14)
   04068 FoxO signaling pathway
    1432 (MAPK14)
   04071 Sphingolipid signaling pathway
    1432 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    1432 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1432 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    1432 (MAPK14)
   04620 Toll-like receptor signaling pathway
    1432 (MAPK14)
   04621 NOD-like receptor signaling pathway
    1432 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    1432 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    1432 (MAPK14)
   04660 T cell receptor signaling pathway
    1432 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    1432 (MAPK14)
   04659 Th17 cell differentiation
    1432 (MAPK14)
   04657 IL-17 signaling pathway
    1432 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    1432 (MAPK14)
   04670 Leukocyte transendothelial migration
    1432 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    1432 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    1432 (MAPK14)
   04917 Prolactin signaling pathway
    1432 (MAPK14)
   04926 Relaxin signaling pathway
    1432 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1432 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    1432 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    1432 (MAPK14)
   04722 Neurotrophin signaling pathway
    1432 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1432 (MAPK14)
  09158 Development
   04380 Osteoclast differentiation
    1432 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    1432 (MAPK14)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    1432 (MAPK14)
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    1432 (MAPK14)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1432 (MAPK14)
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1432 (MAPK14)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1432 (MAPK14)
   05132 Salmonella infection
    1432 (MAPK14)
   05131 Shigellosis
    1432 (MAPK14)
   05133 Pertussis
    1432 (MAPK14)
   05152 Tuberculosis
    1432 (MAPK14)
   05164 Influenza A
    1432 (MAPK14)
   05160 Hepatitis C
    1432 (MAPK14)
   05163 Human cytomegalovirus infection
    1432 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1432 (MAPK14)
   05169 Epstein-Barr virus infection
    1432 (MAPK14)
   05145 Toxoplasmosis
    1432 (MAPK14)
   05140 Leishmaniasis
    1432 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    1432 (MAPK14)
  09168 Drug resistance
   01522 Endocrine resistance
    1432 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1432 (MAPK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     1432 (MAPK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   1432 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 1432
NCBI-ProteinID: NP_001306
OMIM: 600289
HGNC: 6876
Ensembl: ENSG00000112062
Vega: OTTHUMG00000159806
Pharos: Q16539(Tchem)
UniProt: Q16539 L7RSM2
Structure
PDB: 
2FST 5WJJ 4EHV 3ZS5 3OEF 5XYY 3ROC 3K3I 3FMK 2QD9 2FSL 2RG6 2GFS 5MTX 4AA0 3S3I 3KQ7 3HUC 3GC7 3FLY 3FL4 2ZAZ 2NPQ 2FSO 5N68 4F9Y 2FSM 4E5A 3HL7 3ZSG 3NNW 3MPT 5N67 5ML5 3ZYA 3FMH 3FMN 3FLN 3FLQ 3D83 4DLI 2Y8O 3HV6 3HLL 4KIN 6ANL 5O8U 5O8V 5N65 4F9W 4FA2 4EH2 4EH5 4E5B 2YIW 2YIS 3QUD 3O8T 3MVM 3MH0 3KF7 3K3J 3FSK 3FMJ 3FMM 3FKL 3FKN 3FKO 3E92 3E93 2OKR 2I0H 1ZZL 1ZZ2 1ZYJ 1YQJ 1WBT 1R3C 1IAN 3ZSH 4R3C 4E6A 3NWW 5TCO 4L8M 4EWQ 4EH6 4EH7 4EH9 3UVR 3O8P 3O8U 3NNV 3MPA 3MGY 3LFA 3IPH 3HVC 3GFE 3GCU 3FSF 3FML 3FLW 3D7Z 2ZB0 2BAL 1OZ1 1OVE 5MZ3 4ZTH 3U8W 3HP2 1WBO 4EH8 3UVQ 4A9Y 3RIN 3ODY 3MH1 3MH3 3HRB 3HEG 3FI4 2BAK 1W82 1W84 3OCG 1W7H 3FLZ 3ITZ 3HV5 2BAJ 4KIP 3S4Q 3NNX 4AA4 2YIX 3ODZ 3MH2 3HP5 3FLS 1R39 1WFC 5MTY 4AA5 4E6C 5N63 5N64 5N66 5ETF 4EH3 3UVP 3ZSI 3OBJ 3NNU 3L8X 3HV7 3GI3 3FC1 3BX5 3BV2 2RG5 1M7Q 1BMK 1WBW 5ETC 5TBE 3HA8 4KIQ 4EH4 4AAC 3HEC 2ZB1 1W83 1OUY 1OUK 1KV1 1BL7 1BL6 1A9U 3NEW 3OC1 3BV3 4DLJ 3HV4 1DI9 5XYX 3OD6 4E8A 3QUE 5ETA 5ETI 3OBG 3MW1 3MVL 3DT1 3C5U 2BAQ 1KV2 3DS6 3LHJ 2ONL 2LGC 1WBS 1WBV 1WBN
Thumbnails

Position
6p21.31
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Homo sapiens (human): 5600Help
Entry
5600              CDS       T01001                                 

Gene name
MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Network
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5600 (MAPK11)
   04010 MAPK signaling pathway
    5600 (MAPK11)
   04370 VEGF signaling pathway
    5600 (MAPK11)
   04668 TNF signaling pathway
    5600 (MAPK11)
   04068 FoxO signaling pathway
    5600 (MAPK11)
   04071 Sphingolipid signaling pathway
    5600 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5600 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5600 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5600 (MAPK11)
   04620 Toll-like receptor signaling pathway
    5600 (MAPK11)
   04621 NOD-like receptor signaling pathway
    5600 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    5600 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    5600 (MAPK11)
   04660 T cell receptor signaling pathway
    5600 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    5600 (MAPK11)
   04659 Th17 cell differentiation
    5600 (MAPK11)
   04657 IL-17 signaling pathway
    5600 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    5600 (MAPK11)
   04670 Leukocyte transendothelial migration
    5600 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5600 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    5600 (MAPK11)
   04917 Prolactin signaling pathway
    5600 (MAPK11)
   04926 Relaxin signaling pathway
    5600 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5600 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    5600 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    5600 (MAPK11)
   04722 Neurotrophin signaling pathway
    5600 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5600 (MAPK11)
  09158 Development
   04380 Osteoclast differentiation
    5600 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    5600 (MAPK11)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    5600 (MAPK11)
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5600 (MAPK11)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5600 (MAPK11)
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5600 (MAPK11)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5600 (MAPK11)
   05132 Salmonella infection
    5600 (MAPK11)
   05131 Shigellosis
    5600 (MAPK11)
   05133 Pertussis
    5600 (MAPK11)
   05152 Tuberculosis
    5600 (MAPK11)
   05164 Influenza A
    5600 (MAPK11)
   05160 Hepatitis C
    5600 (MAPK11)
   05163 Human cytomegalovirus infection
    5600 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5600 (MAPK11)
   05169 Epstein-Barr virus infection
    5600 (MAPK11)
   05145 Toxoplasmosis
    5600 (MAPK11)
   05140 Leishmaniasis
    5600 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    5600 (MAPK11)
  09168 Drug resistance
   01522 Endocrine resistance
    5600 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5600 (MAPK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5600 (MAPK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5600 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase HABP4_PAI-RBP1
Motif
Other DBs
NCBI-GeneID: 5600
NCBI-ProteinID: NP_002742
OMIM: 602898
HGNC: 6873
Ensembl: ENSG00000185386
Vega: OTTHUMG00000150226
Pharos: Q15759(Tchem)
UniProt: Q15759
Structure
PDB: 

Position
22q13.33
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggatttcgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcagct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Homo sapiens (human): 5603Help
Entry
5603              CDS       T01001                                 

Gene name
MAPK13, MAPK_13, MAPK-13, PRKM13, SAPK4, p38delta
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Network
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5603 (MAPK13)
   04010 MAPK signaling pathway
    5603 (MAPK13)
   04370 VEGF signaling pathway
    5603 (MAPK13)
   04668 TNF signaling pathway
    5603 (MAPK13)
   04068 FoxO signaling pathway
    5603 (MAPK13)
   04071 Sphingolipid signaling pathway
    5603 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5603 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5603 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5603 (MAPK13)
   04620 Toll-like receptor signaling pathway
    5603 (MAPK13)
   04621 NOD-like receptor signaling pathway
    5603 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    5603 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    5603 (MAPK13)
   04660 T cell receptor signaling pathway
    5603 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    5603 (MAPK13)
   04659 Th17 cell differentiation
    5603 (MAPK13)
   04657 IL-17 signaling pathway
    5603 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    5603 (MAPK13)
   04670 Leukocyte transendothelial migration
    5603 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5603 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    5603 (MAPK13)
   04917 Prolactin signaling pathway
    5603 (MAPK13)
   04926 Relaxin signaling pathway
    5603 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5603 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    5603 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    5603 (MAPK13)
   04722 Neurotrophin signaling pathway
    5603 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5603 (MAPK13)
  09158 Development
   04380 Osteoclast differentiation
    5603 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    5603 (MAPK13)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    5603 (MAPK13)
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5603 (MAPK13)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5603 (MAPK13)
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5603 (MAPK13)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5603 (MAPK13)
   05132 Salmonella infection
    5603 (MAPK13)
   05131 Shigellosis
    5603 (MAPK13)
   05133 Pertussis
    5603 (MAPK13)
   05152 Tuberculosis
    5603 (MAPK13)
   05164 Influenza A
    5603 (MAPK13)
   05160 Hepatitis C
    5603 (MAPK13)
   05163 Human cytomegalovirus infection
    5603 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5603 (MAPK13)
   05169 Epstein-Barr virus infection
    5603 (MAPK13)
   05145 Toxoplasmosis
    5603 (MAPK13)
   05140 Leishmaniasis
    5603 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    5603 (MAPK13)
  09168 Drug resistance
   01522 Endocrine resistance
    5603 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5603 (MAPK13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5603 (MAPK13)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5603 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase DUF4023 DUF3231
Motif
Other DBs
NCBI-GeneID: 5603
NCBI-ProteinID: NP_002745
OMIM: 602899
HGNC: 6875
Ensembl: ENSG00000156711
Vega: OTTHUMG00000014587
Pharos: O15264(Tchem)
UniProt: O15264 A0A024RD04
Structure
PDB: 

Position
6p21.31
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagacagcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
tatgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Homo sapiens (human): 6300Help
Entry
6300              CDS       T01001                                 

Gene name
MAPK12, ERK-6, ERK3, ERK6, MAPK_12, P38GAMMA, PRKM12, SAPK-3, SAPK3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Network
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6300 (MAPK12)
   04010 MAPK signaling pathway
    6300 (MAPK12)
   04370 VEGF signaling pathway
    6300 (MAPK12)
   04668 TNF signaling pathway
    6300 (MAPK12)
   04068 FoxO signaling pathway
    6300 (MAPK12)
   04071 Sphingolipid signaling pathway
    6300 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    6300 (MAPK12)
   04218 Cellular senescence
    6300 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6300 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6300 (MAPK12)
   04620 Toll-like receptor signaling pathway
    6300 (MAPK12)
   04621 NOD-like receptor signaling pathway
    6300 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    6300 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    6300 (MAPK12)
   04660 T cell receptor signaling pathway
    6300 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    6300 (MAPK12)
   04659 Th17 cell differentiation
    6300 (MAPK12)
   04657 IL-17 signaling pathway
    6300 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    6300 (MAPK12)
   04670 Leukocyte transendothelial migration
    6300 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6300 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    6300 (MAPK12)
   04917 Prolactin signaling pathway
    6300 (MAPK12)
   04926 Relaxin signaling pathway
    6300 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6300 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    6300 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    6300 (MAPK12)
   04722 Neurotrophin signaling pathway
    6300 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6300 (MAPK12)
  09158 Development
   04380 Osteoclast differentiation
    6300 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    6300 (MAPK12)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    6300 (MAPK12)
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    6300 (MAPK12)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6300 (MAPK12)
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6300 (MAPK12)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6300 (MAPK12)
   05132 Salmonella infection
    6300 (MAPK12)
   05131 Shigellosis
    6300 (MAPK12)
   05133 Pertussis
    6300 (MAPK12)
   05152 Tuberculosis
    6300 (MAPK12)
   05164 Influenza A
    6300 (MAPK12)
   05160 Hepatitis C
    6300 (MAPK12)
   05163 Human cytomegalovirus infection
    6300 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6300 (MAPK12)
   05169 Epstein-Barr virus infection
    6300 (MAPK12)
   05145 Toxoplasmosis
    6300 (MAPK12)
   05140 Leishmaniasis
    6300 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    6300 (MAPK12)
  09168 Drug resistance
   01522 Endocrine resistance
    6300 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6300 (MAPK12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6300 (MAPK12)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6300 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase Peripla_BP_5 UvrD_C
Motif
Other DBs
NCBI-GeneID: 6300
NCBI-ProteinID: NP_002960
OMIM: 602399
HGNC: 6874
Ensembl: ENSG00000188130
Vega: OTTHUMG00000030145
Pharos: P53778(Tchem)
UniProt: P53778
Structure
PDB: 

Position
22q13.33
AA seq 367 aa AA seqDB search
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacggccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cctttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcaggcgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgttgaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacgcctctgtga

DBGET integrated database retrieval system