KEGG   Homo sapiens (human): 143471
Entry
143471            CDS       T01001                                 

Gene name
PSMA8, PSMA7L
Definition
(RefSeq) proteasome 20S subunit alpha 8
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    143471 (PSMA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    143471 (PSMA8)
   05012 Parkinson disease
    143471 (PSMA8)
   05016 Huntington disease
    143471 (PSMA8)
   05017 Spinocerebellar ataxia
    143471 (PSMA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    143471 (PSMA8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    143471 (PSMA8)
   03051 Proteasome [BR:hsa03051]
    143471 (PSMA8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     143471 (PSMA8)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   143471 (PSMA8)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    143471 (PSMA8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    143471 (PSMA8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Myb_DNA-bind_5
Other DBs
NCBI-GeneID: 143471
NCBI-ProteinID: NP_653263
OMIM: 617841
HGNC: 22985
Ensembl: ENSG00000154611
Vega: OTTHUMG00000179426
Pharos: Q8TAA3(Tdark)
UniProt: Q8TAA3
Position
18q11.2
AA seq 256 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
EKEKEEAEKKKSKKSV
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgtctcgatatgacagggcgatcactgtcttctccccagacggacacctttttcaa
gttgaatatgcccaggaagcggtgaagaaaggatccaccgcggtcggaattcgaggtacc
aatatagttgttcttggggtagaaaaaaaatctgttgccaagcttcaagatgaaagaact
gtgaggaaaatttgtgcccttgatgaccatgtctgcatggcttttgcagttttgacaatt
tttataggacttactgctgatgctagagtagtaataaacagagcccgtgtggagtgccag
agccataagcttacggttgaggacccagtcactgtagaatacataactcgcttcatagca
actttaaagcagaaatatacccaaagcaatggacgaagaccttttggtatttctgcctta
attgtaggttttgatgatgatggtatctcaagattgtatcagacagatccttctggtact
tatcatgcttggaaggcaaatgcaataggccgaagtgctaaaactgttcgagaatttcta
gaaaagaattacacagaagatgccatagcaagtgacagtgaagctatcaagttagcaata
aaagctttgctagaagttgtccagtctggtggaaaaaacattgaacttgctataataaga
agaaatcaacctttgaagatgtttagtgcaaaagaagttgaattatatgtaactgaaata
gaaaaggaaaaggaagaagcagagaagaaaaaatcaaagaaatctgtctaa

KEGG   Homo sapiens (human): 5682
Entry
5682              CDS       T01001                                 

Gene name
PSMA1, HC2, HEL-S-275, NU, PROS30
Definition
(RefSeq) proteasome 20S subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5682 (PSMA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5682 (PSMA1)
   05012 Parkinson disease
    5682 (PSMA1)
   05016 Huntington disease
    5682 (PSMA1)
   05017 Spinocerebellar ataxia
    5682 (PSMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5682 (PSMA1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5682 (PSMA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5682 (PSMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5682 (PSMA1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5682 (PSMA1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5682 (PSMA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5682 (PSMA1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5682
NCBI-ProteinID: NP_002777
OMIM: 602854
HGNC: 9530
Ensembl: ENSG00000129084
Vega: OTTHUMG00000165825
Pharos: P25786(Tclin)
UniProt: P25786
Structure
PDB: 

Position
11p15.2
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgaaatcagtatgacaatgatgtcactgtttggagcccccagggcaggattcat
caaattgaatatgcaatggaagctgttaaacaaggttcagccacagttggtctgaaatca
aaaactcatgcagttttggttgcattgaaaagggcgcaatcagagcttgcagctcatcag
aaaaaaattctccatgttgacaaccatattggtatctcaattgcggggcttactgctgat
gctagactgttatgtaattttatgcgtcaggagtgtttggattccagatttgtattcgat
agaccactgcctgtgtctcgtcttgtatctctaattggaagcaagacccagataccaaca
caacgatatggccggagaccatatggtgttggtctccttattgctggttatgatgatatg
ggccctcacattttccaaacctgtccatctgctaactattttgactgcagagccatgtcc
attggagcccgttcccaatcagctcgtacttacttggagagacatatgtctgaatttatg
gagtgtaatttaaatgaactagttaaacatggtctgcgtgccttaagagagacgcttcct
gcagaacaggacctgactacaaagaatgtttccattggaattgttggtaaagacttggag
tttacaatctatgatgatgatgatgtgtctccattcctggaaggtcttgaagaaagacca
cagagaaaggcacagcctgctcaacctgctgatgaacctgcagaaaaggctgatgaacca
atggaacattaa

KEGG   Homo sapiens (human): 5683
Entry
5683              CDS       T01001                                 

Gene name
PSMA2, HC3, MU, PMSA2, PSC2
Definition
(RefSeq) proteasome 20S subunit alpha 2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5683 (PSMA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5683 (PSMA2)
   05012 Parkinson disease
    5683 (PSMA2)
   05016 Huntington disease
    5683 (PSMA2)
   05017 Spinocerebellar ataxia
    5683 (PSMA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5683 (PSMA2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5683 (PSMA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5683 (PSMA2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5683 (PSMA2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5683 (PSMA2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5683
NCBI-ProteinID: NP_002778
OMIM: 176842
HGNC: 9531
Ensembl: ENSG00000106588
Vega: OTTHUMG00000023916
Pharos: P25787(Tbio)
UniProt: P25787 A0A024RA52
Structure
PDB: 

Position
7p14.1
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcggagcgcgggtacagcttttcgctgactacattcagcccgtctggtaaacttgtc
cagattgaatatgctttggctgctgtagctggaggagccccgtccgtgggaattaaagct
gcaaatggtgtggtattagcaactgagaaaaaacagaaatccattctgtatgatgagcga
agtgtacacaaagtagaaccaattaccaagcatataggtttggtgtacagtggcatgggc
cccgattacagagtgcttgtgcacagagctcgaaaactagctcaacaatactatcttgtg
taccaagaacccattcctacagctcagctggtacagagagtagcttctgtgatgcaagaa
tatactcagtcaggtggtgttcgtccatttggagtttctttacttatttgtggttggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaagct
acagcaatgggaaagaactatgtgaatgggaagactttccttgagaaaagatataatgaa
gatctggaacttgaagatgccattcatacagccatcttaaccctaaaggaaagctttgaa
gggcaaatgacagaggataacatagaagttggaatctgcaatgaagctggatttaggagg
cttactccaactgaagttaaggattacttggctgccatagcataa

KEGG   Homo sapiens (human): 5684
Entry
5684              CDS       T01001                                 

Gene name
PSMA3, HC8, PSC3
Definition
(RefSeq) proteasome 20S subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5684 (PSMA3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5684 (PSMA3)
   05012 Parkinson disease
    5684 (PSMA3)
   05016 Huntington disease
    5684 (PSMA3)
   05017 Spinocerebellar ataxia
    5684 (PSMA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5684 (PSMA3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5684 (PSMA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5684 (PSMA3)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5684 (PSMA3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5684 (PSMA3)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5684
NCBI-ProteinID: NP_002779
OMIM: 176843
HGNC: 9532
Ensembl: ENSG00000100567
Vega: OTTHUMG00000140319
Pharos: P25788(Tbio)
UniProt: P25788 A0A140VK43
Structure
PDB: 

Position
14q23.1
AA seq 255 aa
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctcaatcggcactgggtatgacctgtcagcctctacattctctcctgacggaaga
gtttttcaagttgaatatgctatgaaggctgtggaaaatagtagtacagctattggaatc
agatgcaaagatggtgttgtctttggggtagaaaaattagtcctttctaaactttatgaa
gaaggttccaacaaaagactttttaatgttgatcggcatgttggaatggcagtagcaggt
ttgttggcagatgctcgttctttagcagacatagcaagagaagaagcttccaacttcaga
tctaactttggctacaacattccactaaaacatcttgcagacagagtggccatgtatgtg
catgcatatacactctacagtgctgttagaccttttggctgcagtttcatgttagggtct
tacagtgtgaatgacggtgcgcaactctacatgattgacccatcaggtgtttcatacggt
tattggggctgtgccatcggcaaagccaggcaagctgcaaagacggaaatagagaagctt
cagatgaaagaaatgacctgccgtgatatcgttaaagaagttgcaaaaataatttacata
gtacatgacgaagttaaggataaagcttttgaactagaactcagctgggttggtgaatta
actaatggaagacatgaaattgttccaaaagatataagagaagaagcagagaaatatgct
aaggaatctctgaaggaagaagatgaatcagatgatgataatatgtaa

KEGG   Homo sapiens (human): 5685
Entry
5685              CDS       T01001                                 

Gene name
PSMA4, HC9, HsT17706, PSC9
Definition
(RefSeq) proteasome 20S subunit alpha 4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5685 (PSMA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5685 (PSMA4)
   05012 Parkinson disease
    5685 (PSMA4)
   05016 Huntington disease
    5685 (PSMA4)
   05017 Spinocerebellar ataxia
    5685 (PSMA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5685 (PSMA4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5685 (PSMA4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5685 (PSMA4)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5685 (PSMA4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5685 (PSMA4)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N TRP_N Phenol_monoox
Other DBs
NCBI-GeneID: 5685
NCBI-ProteinID: NP_001096137
OMIM: 176846
HGNC: 9533
Ensembl: ENSG00000041357
Vega: OTTHUMG00000143859
Pharos: P25789(Tbio)
UniProt: P25789
Structure
PDB: 

Position
15q25.1
AA seq 261 aa
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctcgaagatatgactccaggaccactatattttctccagaaggtcgcttataccaa
gttgaatatgccatggaagctattggacatgcaggcacctgtttgggaattttagcaaat
gatggtgttttgcttgcagcagagagacgcaacatccacaagcttcttgatgaagtcttt
ttttctgaaaaaatttataaactcaatgaggacatggcttgcagtgtggcaggcataact
tctgatgctaatgttctgactaatgaactaaggctcattgctcaaaggtatttattacag
tatcaggagccaataccttgtgagcagttggttacagcgctgtgtgatatcaaacaagct
tatacacaatttggaggaaaacgtccctttggtgtttcattgctgtacattggctgggat
aagcactatggctttcagctctatcagagtgaccctagtggaaattacgggggatggaag
gccacatgcattggaaataatagcgctgcagctgtgtcaatgttgaaacaagactataaa
gaaggagaaatgaccttgaagtcagcacttgctttagctatcaaagtactaaataagacc
atggatgttagtaaactctctgctgaaaaagtggaaattgcaacactaacaagagagaat
ggaaagacagtaatcagagttctcaaacaaaaagaagtggagcagttgatcaaaaaacat
gaggaagaagaagccaaagctgagcgtgagaagaaagaaaaagaacagaaagaaaaggat
aaatag

KEGG   Homo sapiens (human): 5686
Entry
5686              CDS       T01001                                 

Gene name
PSMA5, PSC5, ZETA
Definition
(RefSeq) proteasome 20S subunit alpha 5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5686 (PSMA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5686 (PSMA5)
   05012 Parkinson disease
    5686 (PSMA5)
   05016 Huntington disease
    5686 (PSMA5)
   05017 Spinocerebellar ataxia
    5686 (PSMA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5686 (PSMA5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5686 (PSMA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5686 (PSMA5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5686 (PSMA5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5686 (PSMA5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5686
NCBI-ProteinID: NP_002781
OMIM: 176844
HGNC: 9534
Ensembl: ENSG00000143106
Vega: OTTHUMG00000012001
Pharos: P28066(Tbio)
UniProt: P28066 A0A109NGN6
Structure
PDB: 

Position
1p13.3
AA seq 241 aa
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtttcttacccggtctgagtacgacaggggcgtgaatactttttctcccgaaggaaga
ttatttcaagtggaatatgccattgaggctatcaagcttggttctacagccattgggatc
cagacatcagagggtgtgtgcctagctgtggagaagagaattacttccccactgatggag
cccagcagcattgagaaaattgtagagattgatgctcacataggttgtgccatgagtggg
ctaattgctgatgctaagactttaattgataaagccagagtggagacacagaaccactgg
ttcacctacaatgagacaatgacagtggagagtgtgacccaagctgtgtccaatctggct
ttgcagtttggagaagaagatgcagatccaggtgccatgtctcgtccctttggagtagca
ttattatttggaggagttgatgagaaaggaccccagctgtttcatatggacccatctggg
acctttgtacagtgtgatgctcgagcaattggctctgcttcagagggtgcccagagctcc
ttgcaagaagtttaccacaagtctatgactttgaaagaagccatcaagtcttcactcatc
atcctcaaacaagtaatggaggagaagctgaatgcaacaaacattgagctagccacagtg
cagcctggccagaatttccacatgttcacaaaggaagaacttgaagaggttatcaaggac
atttaa

KEGG   Homo sapiens (human): 5687
Entry
5687              CDS       T01001                                 

Gene name
PSMA6, IOTA, PROS27, p27K
Definition
(RefSeq) proteasome 20S subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5687 (PSMA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5687 (PSMA6)
   05012 Parkinson disease
    5687 (PSMA6)
   05016 Huntington disease
    5687 (PSMA6)
   05017 Spinocerebellar ataxia
    5687 (PSMA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5687 (PSMA6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5687 (PSMA6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5687 (PSMA6)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5687 (PSMA6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5687 (PSMA6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5687
NCBI-ProteinID: NP_002782
OMIM: 602855
HGNC: 9535
Ensembl: ENSG00000100902
Vega: OTTHUMG00000140221
Pharos: P60900(Tbio)
UniProt: P60900 A0A140VK44
Structure
PDB: 

Position
14q13.2
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccgtggttccagcgccggttttgaccgccacattaccattttttcacccgagggt
cggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagta
gctgtcagagggaaagactgtgcagtaattgtcacacagaagaaagtacctgacaaatta
ttggattccagcacagtgactcacttattcaagataactgaaaacattggttgtgtgatg
accggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaac
tggaaatacaagtatggctatgagattcctgtggacatgctgtgtaaaagaattgccgat
atttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaggtatataagtgtgatcctgcaggttactac
tgtgggtttaaagccactgcagcgggagttaaacaaactgagtcaaccagcttccttgaa
aaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtg
acagttgaaaatcctaaattcaggattcttacagaagcagagattgatgctcaccttgtt
gctctagcagagagagactaa

KEGG   Homo sapiens (human): 5688
Entry
5688              CDS       T01001                                 

Gene name
PSMA7, C6, HEL-S-276, HSPC, RC6-1, XAPC7
Definition
(RefSeq) proteasome 20S subunit alpha 7
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5688 (PSMA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5688 (PSMA7)
   05012 Parkinson disease
    5688 (PSMA7)
   05016 Huntington disease
    5688 (PSMA7)
   05017 Spinocerebellar ataxia
    5688 (PSMA7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5688 (PSMA7)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5688 (PSMA7)
   03051 Proteasome [BR:hsa03051]
    5688 (PSMA7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5688 (PSMA7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5688 (PSMA7)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    5688 (PSMA7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5688 (PSMA7)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Peptidase_C65 DUF5069
Other DBs
NCBI-GeneID: 5688
NCBI-ProteinID: NP_002783
OMIM: 606607
HGNC: 9536
Ensembl: ENSG00000101182
Vega: OTTHUMG00000032895
Pharos: O14818(Tbio)
UniProt: O14818 A0A0K0K1K4
Structure
PDB: 

Position
20q13.33
AA seq 248 aa
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagctacgaccgcgccatcaccgtcttctcgcccgacggccacctcttccaagtggag
tacgcgcaggaggccgtcaagaagggctcgaccgcggttggtgttcgaggaagagacatt
gttgttcttggtgtggagaagaagtcagtggccaaactgcaggatgaaagaacagtgcgg
aagatctgtgctttggatgacaacgtctgcatggcctttgcaggcctcaccgccgatgca
aggatagtcatcaacagggcccgggtggagtgccagagccaccggctgactgtggaggac
ccggtcactgtggagtacatcacccgctacatcgccagtctgaagcagcgttatacgcag
agcaatgggcgcaggccgtttggcatctctgccctcatcgtgggtttcgactttgatggc
actcctaggctctatcagactgacccctcgggcacataccatgcctggaaggccaatgcc
ataggtcggggtgccaagtcagtgcgcgagttcctggagaagaactatactgacgaagcc
attgaaacagatgatctgaccattaagctggtgatcaaggcactcctggaagtggttcag
tcaggtggcaaaaacattgaacttgctgtcatgaggcgagatcaatccctcaagatttta
aatcctgaagaaattgagaagtatgttgctgaaattgaaaaagaaaaagaagaaaacgaa
aagaagaaacaaaagaaagcatcatga

KEGG   Homo sapiens (human): 5689
Entry
5689              CDS       T01001                                 

Gene name
PSMB1, HC5, PMSB1, PSC5
Definition
(RefSeq) proteasome 20S subunit beta 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Drug target
Delanzomib: D10110
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5689 (PSMB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5689 (PSMB1)
   05012 Parkinson disease
    5689 (PSMB1)
   05016 Huntington disease
    5689 (PSMB1)
   05017 Spinocerebellar ataxia
    5689 (PSMB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5689 (PSMB1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5689 (PSMB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5689 (PSMB1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5689 (PSMB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5689 (PSMB1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 5689
NCBI-ProteinID: NP_002784
OMIM: 602017
HGNC: 9537
Ensembl: ENSG00000008018
Vega: OTTHUMG00000016087
Pharos: P20618(Tclin)
UniProt: P20618 A0A140VK45
Structure
PDB: 

Position
6q27
AA seq 241 aa
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgtcctctacagccatgtattcggctcctggcagagacttggggatggaaccgcac
agagccgcgggccctttgcagctgcgattttcgccctacgttttcaacggaggtactata
ctggcaattgctggagaagattttgcaattgttgcttctgatactcgattgagtgaaggg
ttttcaattcatacgcgggatagccccaaatgttacaaattaacagacaaaacagtcatt
ggatgcagcggttttcatggagactgtcttacgctgacaaagattattgaagcaagacta
aagatgtataagcattccaataataaggccatgactacgggggcaattgctgcaatgctg
tctacaatcctgtattcaaggcgcttctttccatactatgtttacaacatcatcggtgga
cttgatgaagaaggaaagggggctgtatacagctttgatccagtagggtcttaccagaga
gactccttcaaggctggaggctcagcaagtgccatgctacagcccctgcttgacaaccag
gttggttttaagaacatgcagaatgtggagcatgttccgctgtccttggacagagccatg
cggctggtgaaagatgtcttcatttctgcggctgagagagatgtgtacactggggacgca
ctccggatctgcatagtgaccaaagagggcatcagggaggaaactgtttccttaaggaag
gactga

KEGG   Homo sapiens (human): 5690
Entry
5690              CDS       T01001                                 

Gene name
PSMB2, HC7-I
Definition
(RefSeq) proteasome 20S subunit beta 2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Drug target
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5690 (PSMB2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5690 (PSMB2)
   05012 Parkinson disease
    5690 (PSMB2)
   05016 Huntington disease
    5690 (PSMB2)
   05017 Spinocerebellar ataxia
    5690 (PSMB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5690 (PSMB2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5690 (PSMB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5690 (PSMB2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5690 (PSMB2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5690 (PSMB2)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5690
NCBI-ProteinID: NP_002785
OMIM: 602175
HGNC: 9539
Ensembl: ENSG00000126067
Vega: OTTHUMG00000004169
Pharos: P49721(Tclin)
UniProt: P49721 A0A140VJS6
Structure
PDB: 

Position
1p34.3
AA seq 201 aa
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagtacctcatcggtatccaaggccccgactatgttcttgtcgcctccgaccgggtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aagatattactcctgtgtgttggagaggctggagacactgtacagtttgcagaatatatt
cagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacggcagca
gctaacttcacacgccgaaacctggctgactgtcttcggagtcggaccccatatcatgtg
aacctcctcctggctggctatgatgagcatgaagggccagcgctgtattacatggactac
ctggcagccttggccaaggccccttttgcagcccacggctatggtgccttcctgactctc
agtatcctcgaccgatactacacaccgactatctcacgtgagagggcagtggaactcctt
aggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgtt
cgaatcattgacaaaaatggcatccatgacctggataacatttccttccccaaacagggc
tcctaa

KEGG   Homo sapiens (human): 5691
Entry
5691              CDS       T01001                                 

Gene name
PSMB3, HC10-II
Definition
(RefSeq) proteasome 20S subunit beta 3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5691 (PSMB3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5691 (PSMB3)
   05012 Parkinson disease
    5691 (PSMB3)
   05016 Huntington disease
    5691 (PSMB3)
   05017 Spinocerebellar ataxia
    5691 (PSMB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5691 (PSMB3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5691 (PSMB3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5691 (PSMB3)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5691 (PSMB3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5691 (PSMB3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5691
NCBI-ProteinID: NP_002786
OMIM: 602176
HGNC: 9540
Ensembl: ENSG00000277791
Vega: OTTHUMG00000188503
Pharos: P49720(Tdark)
UniProt: P49720 A0A384NL22
Structure
PDB: 

Position
17q12
AA seq 205 aa
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctattatgtcctataacggaggggccgtcatggccatgaaggggaagaactgtgtg
gccatcgctgcagacaggcgcttcgggatccaggcccagatggtgaccacggacttccag
aagatctttcccatgggtgaccggctgtacatcggtctggccgggctcgccactgacgtc
cagacagttgcccagcgcctcaagttccggctgaacctgtatgagttgaaggaaggtcgg
cagatcaaaccttataccctcatgagcatggtggccaacctcttgtatgagaaacggttt
ggcccttactacactgagccagtcattgccgggttggacccgaagacctttaagcccttc
atttgctctctagacctcatcggctgccccatggtgactgatgactttgtggtcagtggc
acctgcgccgaacaaatgtacggaatgtgtgagtccctctgggagcccaacatggatccg
gatcacctgtttgaaaccatctcccaagccatgctgaatgctgtggaccgggatgcagtg
tcaggcatgggagtcattgtccacatcatcgagaaggacaaaatcaccaccaggacactg
aaggcccgaatggactaa

KEGG   Homo sapiens (human): 5692
Entry
5692              CDS       T01001                                 

Gene name
PSMB4, HN3, HsN3, PRAAS3, PROS-26, PROS26
Definition
(RefSeq) proteasome 20S subunit beta 4
  KO
K02736  20S proteasome subunit beta 7 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5692 (PSMB4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5692 (PSMB4)
   05012 Parkinson disease
    5692 (PSMB4)
   05016 Huntington disease
    5692 (PSMB4)
   05017 Spinocerebellar ataxia
    5692 (PSMB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5692 (PSMB4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5692 (PSMB4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5692 (PSMB4)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5692 (PSMB4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5692 (PSMB4)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5692
NCBI-ProteinID: NP_002787
OMIM: 602177
HGNC: 9541
Ensembl: ENSG00000159377
Vega: OTTHUMG00000012494
Pharos: P28070(Tbio)
UniProt: P28070 A0A140VK46
Structure
PDB: 

Position
1q21.3
AA seq 264 aa
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaagcgtttttggggtcgcggtccggactttgggcggggggtccggccccaggacag
ttttaccgcattccgtccactcccgattccttcatggatccggcgtctgcactttacaga
ggtccaatcacgcggacccagaaccccatggtgaccgggacctcagtcctcggcgttaag
ttcgagggcggagtggtgattgccgcagacatgctgggatcctacggctccttggctcgt
ttccgcaacatctctcgcattatgcgagtcaacaacagtaccatgctgggtgcctctggc
gactacgctgatttccagtatttgaagcaagttctcggccagatggtgattgatgaggag
cttctgggagatggacacagctatagtcctagagctattcattcatggctgaccagggcc
atgtacagccggcgctcgaagatgaaccctttgtggaacaccatggtcatcggaggctat
gctgatggagagagcttcctcggttatgtggacatgcttggtgtagcctatgaagcccct
tcgctggccactggttatggtgcatacttggctcagcctctgctgcgagaagttctggag
aagcagccagtgctaagccagaccgaggcccgcgacttagtagaacgctgcatgcgagtg
ctgtactaccgagatgcccgttcttacaaccggtttcaaatcgccactgtcaccgaaaaa
ggtgttgaaatagagggaccattgtctacagagaccaactgggatattgcccacatgatc
agtggctttgaatga

KEGG   Homo sapiens (human): 5693
Entry
5693              CDS       T01001                                 

Gene name
PSMB5, LMPX, MB1, X
Definition
(RefSeq) proteasome 20S subunit beta 5
  KO
K02737  20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Drug target
Bortezomib: D03150
Carfilzomib: D08880
Delanzomib: D10110
Ixazomib (DG01269): D10130 D10131
Marizomib: D09640
Oprozomib: D10318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5693 (PSMB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5693 (PSMB5)
   05012 Parkinson disease
    5693 (PSMB5)
   05016 Huntington disease
    5693 (PSMB5)
   05017 Spinocerebellar ataxia
    5693 (PSMB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5693 (PSMB5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5693 (PSMB5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5693 (PSMB5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5693 (PSMB5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5693 (PSMB5)
SSDB
Motif
Pfam: Proteasome DUF3991
Other DBs
NCBI-GeneID: 5693
NCBI-ProteinID: NP_002788
OMIM: 600306
HGNC: 9542
Ensembl: ENSG00000100804
Vega: OTTHUMG00000028713
Pharos: P28074(Tclin)
UniProt: P28074
Structure
PDB: 

Position
14q11.2
AA seq 263 aa
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgcttgccagcgtgttggagagaccgctaccggtgaaccagcgcgggtttttcgga
cttgggggtcgtgcagatctgctggatctaggtccagggagtctcagtgatggtctgagc
ctggccgcgccaggctggggtgtcccagaagagccaggaatcgaaatgcttcatggaaca
accaccctggccttcaagttccgccatggagtcatagttgcagctgactccagggctaca
gcgggtgcttacattgcctcccagacggtgaagaaggtgatagagatcaacccatacctg
ctaggcaccatggctgggggcgcagcggattgcagcttctgggaacggctgttggctcgg
caatgtcgaatctatgagcttcgaaataaggaacgcatctctgtagcagctgcctccaaa
ctgcttgccaacatggtgtatcagtacaaaggcatggggctgtccatgggcaccatgatc
tgtggctgggataagagaggccctggcctctactacgtggacagtgaagggaaccggatt
tcaggggccaccttctctgtaggttctggctctgtgtatgcatatggggtcatggatcgg
ggctattcctatgacctggaagtggagcaggcctatgatctggcccgtcgagccatctac
caagccacctacagagatgcctactcaggaggtgcagtcaacctctaccacgtgcgggag
gatggctggatccgagtctccagtgacaatgtggctgatctacatgagaagtatagtggc
tctaccccctga

KEGG   Homo sapiens (human): 5694
Entry
5694              CDS       T01001                                 

Gene name
PSMB6, DELTA, LMPY, Y
Definition
(RefSeq) proteasome 20S subunit beta 6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5694 (PSMB6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5694 (PSMB6)
   05012 Parkinson disease
    5694 (PSMB6)
   05016 Huntington disease
    5694 (PSMB6)
   05017 Spinocerebellar ataxia
    5694 (PSMB6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5694 (PSMB6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5694 (PSMB6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5694 (PSMB6)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5694 (PSMB6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5694 (PSMB6)
SSDB
Motif
Pfam: Proteasome DUF1502
Other DBs
NCBI-GeneID: 5694
NCBI-ProteinID: NP_002789
OMIM: 600307
HGNC: 9543
Ensembl: ENSG00000142507
Vega: OTTHUMG00000090777
Pharos: P28072(Tbio)
UniProt: P28072 Q6IAT9
Structure
PDB: 

Position
17p13.2
AA seq 239 aa
MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcggctaccttactagctgctcggggagccgggccagcaccggcttgggggccggag
gcgttcactccagactgggaaagccgagaagtttccactgggaccactatcatggccgtg
cagtttgacgggggcgtggttctgggggcggactccagaacaaccactgggtcctacatc
gccaatcgagtgactgacaagctgacacctattcacgaccgcattttctgctgtcgctca
ggctcagctgctgatacccaggcagtagctgatgctgtcacctaccagctcggtttccac
agcattgaactgaatgagcctccactggtccacacagcagccagcctctttaaggagatg
tgttaccgataccgggaagacctgatggcgggaatcatcatcgcaggctgggaccctcaa
gaaggagggcaggtgtactcagtgcctatggggggtatgatggtaaggcagtcctttgcc
attggaggctccgggagctcctacatctatggctatgttgatgctacctaccgggaaggc
atgaccaaggaagagtgtctgcaattcactgccaatgctctcgctttggccatggagcgg
gatggctccagtggaggagtgatccgcctggcagccattgcagagtcaggggtagagcgg
caagtacttttgggagaccagatacccaaattcgccgttgccactttaccacccgcctga

KEGG   Homo sapiens (human): 5695
Entry
5695              CDS       T01001                                 

Gene name
PSMB7, Z
Definition
(RefSeq) proteasome 20S subunit beta 7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5695 (PSMB7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5695 (PSMB7)
   05012 Parkinson disease
    5695 (PSMB7)
   05016 Huntington disease
    5695 (PSMB7)
   05017 Spinocerebellar ataxia
    5695 (PSMB7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5695 (PSMB7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5695 (PSMB7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5695 (PSMB7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5695 (PSMB7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5695 (PSMB7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 5695
NCBI-ProteinID: NP_002790
OMIM: 604030
HGNC: 9544
Ensembl: ENSG00000136930
Vega: OTTHUMG00000021042
Pharos: Q99436(Tbio)
UniProt: Q99436 E9KL30
Structure
PDB: 

Position
9q33.3
AA seq 277 aa
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtatgctccaccagttggaggcttctcttttgataactgccgc
aggaatgccgtcttggaagccgattttgcaaagaggggatacaagcttccaaaggtccgg
aaaactggcacgaccatcgctggggtggtctataaggatggcatagttcttggagcagat
acaagagcaactgaagggatggttgttgctgacaagaactgttcaaaaatacacttcata
tctcctaatatttattgttgtggtgctgggacagctgcagacacagacatgacaacccag
ctcatttcttccaacctggagctccactccctctccactggccgtcttcccagagttgtg
acagccaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttagggggagtagatgttactggacctcacctctacagcatctatcctcatgga
tcaactgataagttgccttatgtcaccatgggttctggctccttggcagcaatggctgta
tttgaagataagtttaggccagacatggaggaggaggaagccaagaatctggtgagcgaa
gccatcgcagctggcatcttcaacgacctgggctccggaagcaacattgacctctgcgtc
atcagcaagaacaagctggattttctccgcccatacacagtgcccaacaagaaggggacc
aggcttggccggtacaggtgtgagaaagggactactgcagtcctcactgagaaaatcact
cctctggagattgaggtgctggaagaaacagtccaaacaatggacacttcctga

DBGET integrated database retrieval system