KEGG   Homo sapiens (human): 143471
Entry
143471            CDS       T01001                                 
Symbol
PSMA8, PSMA7L
Name
(RefSeq) proteasome 20S subunit alpha 8
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    143471 (PSMA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    143471 (PSMA8)
   05012 Parkinson disease
    143471 (PSMA8)
   05014 Amyotrophic lateral sclerosis
    143471 (PSMA8)
   05016 Huntington disease
    143471 (PSMA8)
   05017 Spinocerebellar ataxia
    143471 (PSMA8)
   05020 Prion disease
    143471 (PSMA8)
   05022 Pathways of neurodegeneration - multiple diseases
    143471 (PSMA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    143471 (PSMA8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    143471 (PSMA8)
   03051 Proteasome [BR:hsa03051]
    143471 (PSMA8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     143471 (PSMA8)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   143471 (PSMA8)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    143471 (PSMA8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    143471 (PSMA8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Myb_DNA-bind_5 DUF4372
Other DBs
NCBI-GeneID: 143471
NCBI-ProteinID: NP_653263
OMIM: 617841
HGNC: 22985
Ensembl: ENSG00000154611
Pharos: Q8TAA3(Tdark)
UniProt: Q8TAA3
Position
18:26133869..26193355
AA seq 256 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
EKEKEEAEKKKSKKSV
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgtctcgatatgacagggcgatcactgtcttctccccagacggacacctttttcaa
gttgaatatgcccaggaagcggtgaagaaaggatccaccgcggtcggaattcgaggtacc
aatatagttgttcttggggtagaaaaaaaatctgttgccaagcttcaagatgaaagaact
gtgaggaaaatttgtgcccttgatgaccatgtctgcatggcttttgcagttttgacaatt
tttataggacttactgctgatgctagagtagtaataaacagagcccgtgtggagtgccag
agccataagcttacggttgaggacccagtcactgtagaatacataactcgcttcatagca
actttaaagcagaaatatacccaaagcaatggacgaagaccttttggtatttctgcctta
attgtaggttttgatgatgatggtatctcaagattgtatcagacagatccttctggtact
tatcatgcttggaaggcaaatgcaataggccgaagtgctaaaactgttcgagaatttcta
gaaaagaattacacagaagatgccatagcaagtgacagtgaagctatcaagttagcaata
aaagctttgctagaagttgtccagtctggtggaaaaaacattgaacttgctataataaga
agaaatcaacctttgaagatgtttagtgcaaaagaagttgaattatatgtaactgaaata
gaaaaggaaaaggaagaagcagagaagaaaaaatcaaagaaatctgtctaa

KEGG   Homo sapiens (human): 5682
Entry
5682              CDS       T01001                                 
Symbol
PSMA1, HC2, HEL-S-275, NU, PROS30
Name
(RefSeq) proteasome 20S subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5682 (PSMA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5682 (PSMA1)
   05012 Parkinson disease
    5682 (PSMA1)
   05014 Amyotrophic lateral sclerosis
    5682 (PSMA1)
   05016 Huntington disease
    5682 (PSMA1)
   05017 Spinocerebellar ataxia
    5682 (PSMA1)
   05020 Prion disease
    5682 (PSMA1)
   05022 Pathways of neurodegeneration - multiple diseases
    5682 (PSMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5682 (PSMA1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5682 (PSMA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5682 (PSMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5682 (PSMA1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5682 (PSMA1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5682 (PSMA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5682 (PSMA1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5682
NCBI-ProteinID: NP_002777
OMIM: 602854
HGNC: 9530
Ensembl: ENSG00000129084
Pharos: P25786(Tclin)
UniProt: P25786
Structure
Position
11:complement(14504876..14643662)
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgaaatcagtatgacaatgatgtcactgtttggagcccccagggcaggattcat
caaattgaatatgcaatggaagctgttaaacaaggttcagccacagttggtctgaaatca
aaaactcatgcagttttggttgcattgaaaagggcgcaatcagagcttgcagctcatcag
aaaaaaattctccatgttgacaaccatattggtatctcaattgcggggcttactgctgat
gctagactgttatgtaattttatgcgtcaggagtgtttggattccagatttgtattcgat
agaccactgcctgtgtctcgtcttgtatctctaattggaagcaagacccagataccaaca
caacgatatggccggagaccatatggtgttggtctccttattgctggttatgatgatatg
ggccctcacattttccaaacctgtccatctgctaactattttgactgcagagccatgtcc
attggagcccgttcccaatcagctcgtacttacttggagagacatatgtctgaatttatg
gagtgtaatttaaatgaactagttaaacatggtctgcgtgccttaagagagacgcttcct
gcagaacaggacctgactacaaagaatgtttccattggaattgttggtaaagacttggag
tttacaatctatgatgatgatgatgtgtctccattcctggaaggtcttgaagaaagacca
cagagaaaggcacagcctgctcaacctgctgatgaacctgcagaaaaggctgatgaacca
atggaacattaa

KEGG   Homo sapiens (human): 5683
Entry
5683              CDS       T01001                                 
Symbol
PSMA2, HC3, MU, PMSA2, PSC2
Name
(RefSeq) proteasome 20S subunit alpha 2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5683 (PSMA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5683 (PSMA2)
   05012 Parkinson disease
    5683 (PSMA2)
   05014 Amyotrophic lateral sclerosis
    5683 (PSMA2)
   05016 Huntington disease
    5683 (PSMA2)
   05017 Spinocerebellar ataxia
    5683 (PSMA2)
   05020 Prion disease
    5683 (PSMA2)
   05022 Pathways of neurodegeneration - multiple diseases
    5683 (PSMA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5683 (PSMA2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5683 (PSMA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5683 (PSMA2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5683 (PSMA2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5683 (PSMA2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5683
NCBI-ProteinID: NP_002778
OMIM: 176842
HGNC: 9531
Ensembl: ENSG00000106588
Pharos: P25787(Tbio)
UniProt: P25787 A0A024RA52
Structure
Position
7:complement(42916861..42932174)
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcggagcgcgggtacagcttttcgctgactacattcagcccgtctggtaaacttgtc
cagattgaatatgctttggctgctgtagctggaggagccccgtccgtgggaattaaagct
gcaaatggtgtggtattagcaactgagaaaaaacagaaatccattctgtatgatgagcga
agtgtacacaaagtagaaccaattaccaagcatataggtttggtgtacagtggcatgggc
cccgattacagagtgcttgtgcacagagctcgaaaactagctcaacaatactatcttgtg
taccaagaacccattcctacagctcagctggtacagagagtagcttctgtgatgcaagaa
tatactcagtcaggtggtgttcgtccatttggagtttctttacttatttgtggttggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaagct
acagcaatgggaaagaactatgtgaatgggaagactttccttgagaaaagatataatgaa
gatctggaacttgaagatgccattcatacagccatcttaaccctaaaggaaagctttgaa
gggcaaatgacagaggataacatagaagttggaatctgcaatgaagctggatttaggagg
cttactccaactgaagttaaggattacttggctgccatagcataa

KEGG   Homo sapiens (human): 5684
Entry
5684              CDS       T01001                                 
Symbol
PSMA3, HC8, PSC3
Name
(RefSeq) proteasome 20S subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5684 (PSMA3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5684 (PSMA3)
   05012 Parkinson disease
    5684 (PSMA3)
   05014 Amyotrophic lateral sclerosis
    5684 (PSMA3)
   05016 Huntington disease
    5684 (PSMA3)
   05017 Spinocerebellar ataxia
    5684 (PSMA3)
   05020 Prion disease
    5684 (PSMA3)
   05022 Pathways of neurodegeneration - multiple diseases
    5684 (PSMA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5684 (PSMA3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5684 (PSMA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5684 (PSMA3)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5684 (PSMA3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5684 (PSMA3)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5684
NCBI-ProteinID: NP_002779
OMIM: 176843
HGNC: 9532
Ensembl: ENSG00000100567
Pharos: P25788(Tbio)
UniProt: P25788 A0A140VK43
Structure
Position
14:58244843..58272004
AA seq 255 aa
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctcaatcggcactgggtatgacctgtcagcctctacattctctcctgacggaaga
gtttttcaagttgaatatgctatgaaggctgtggaaaatagtagtacagctattggaatc
agatgcaaagatggtgttgtctttggggtagaaaaattagtcctttctaaactttatgaa
gaaggttccaacaaaagactttttaatgttgatcggcatgttggaatggcagtagcaggt
ttgttggcagatgctcgttctttagcagacatagcaagagaagaagcttccaacttcaga
tctaactttggctacaacattccactaaaacatcttgcagacagagtggccatgtatgtg
catgcatatacactctacagtgctgttagaccttttggctgcagtttcatgttagggtct
tacagtgtgaatgacggtgcgcaactctacatgattgacccatcaggtgtttcatacggt
tattggggctgtgccatcggcaaagccaggcaagctgcaaagacggaaatagagaagctt
cagatgaaagaaatgacctgccgtgatatcgttaaagaagttgcaaaaataatttacata
gtacatgacgaagttaaggataaagcttttgaactagaactcagctgggttggtgaatta
actaatggaagacatgaaattgttccaaaagatataagagaagaagcagagaaatatgct
aaggaatctctgaaggaagaagatgaatcagatgatgataatatgtaa

KEGG   Homo sapiens (human): 5685
Entry
5685              CDS       T01001                                 
Symbol
PSMA4, HC9, HsT17706, PSC9
Name
(RefSeq) proteasome 20S subunit alpha 4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5685 (PSMA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5685 (PSMA4)
   05012 Parkinson disease
    5685 (PSMA4)
   05014 Amyotrophic lateral sclerosis
    5685 (PSMA4)
   05016 Huntington disease
    5685 (PSMA4)
   05017 Spinocerebellar ataxia
    5685 (PSMA4)
   05020 Prion disease
    5685 (PSMA4)
   05022 Pathways of neurodegeneration - multiple diseases
    5685 (PSMA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5685 (PSMA4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5685 (PSMA4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5685 (PSMA4)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5685 (PSMA4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5685 (PSMA4)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N DsrH TRP_N
Other DBs
NCBI-GeneID: 5685
NCBI-ProteinID: NP_001096137
OMIM: 176846
HGNC: 9533
Ensembl: ENSG00000041357
Pharos: P25789(Tbio)
UniProt: P25789
Structure
Position
15:78540405..78552417
AA seq 261 aa
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctcgaagatatgactccaggaccactatattttctccagaaggtcgcttataccaa
gttgaatatgccatggaagctattggacatgcaggcacctgtttgggaattttagcaaat
gatggtgttttgcttgcagcagagagacgcaacatccacaagcttcttgatgaagtcttt
ttttctgaaaaaatttataaactcaatgaggacatggcttgcagtgtggcaggcataact
tctgatgctaatgttctgactaatgaactaaggctcattgctcaaaggtatttattacag
tatcaggagccaataccttgtgagcagttggttacagcgctgtgtgatatcaaacaagct
tatacacaatttggaggaaaacgtccctttggtgtttcattgctgtacattggctgggat
aagcactatggctttcagctctatcagagtgaccctagtggaaattacgggggatggaag
gccacatgcattggaaataatagcgctgcagctgtgtcaatgttgaaacaagactataaa
gaaggagaaatgaccttgaagtcagcacttgctttagctatcaaagtactaaataagacc
atggatgttagtaaactctctgctgaaaaagtggaaattgcaacactaacaagagagaat
ggaaagacagtaatcagagttctcaaacaaaaagaagtggagcagttgatcaaaaaacat
gaggaagaagaagccaaagctgagcgtgagaagaaagaaaaagaacagaaagaaaaggat
aaatag

KEGG   Homo sapiens (human): 5686
Entry
5686              CDS       T01001                                 
Symbol
PSMA5, PSC5, ZETA
Name
(RefSeq) proteasome 20S subunit alpha 5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5686 (PSMA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5686 (PSMA5)
   05012 Parkinson disease
    5686 (PSMA5)
   05014 Amyotrophic lateral sclerosis
    5686 (PSMA5)
   05016 Huntington disease
    5686 (PSMA5)
   05017 Spinocerebellar ataxia
    5686 (PSMA5)
   05020 Prion disease
    5686 (PSMA5)
   05022 Pathways of neurodegeneration - multiple diseases
    5686 (PSMA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5686 (PSMA5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5686 (PSMA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5686 (PSMA5)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5686 (PSMA5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5686 (PSMA5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5686
NCBI-ProteinID: NP_002781
OMIM: 176844
HGNC: 9534
Ensembl: ENSG00000143106
Pharos: P28066(Tbio)
UniProt: P28066 A0A109NGN6
Structure
Position
1:complement(109399042..109426448)
AA seq 241 aa
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtttcttacccggtctgagtacgacaggggcgtgaatactttttctcccgaaggaaga
ttatttcaagtggaatatgccattgaggctatcaagcttggttctacagccattgggatc
cagacatcagagggtgtgtgcctagctgtggagaagagaattacttccccactgatggag
cccagcagcattgagaaaattgtagagattgatgctcacataggttgtgccatgagtggg
ctaattgctgatgctaagactttaattgataaagccagagtggagacacagaaccactgg
ttcacctacaatgagacaatgacagtggagagtgtgacccaagctgtgtccaatctggct
ttgcagtttggagaagaagatgcagatccaggtgccatgtctcgtccctttggagtagca
ttattatttggaggagttgatgagaaaggaccccagctgtttcatatggacccatctggg
acctttgtacagtgtgatgctcgagcaattggctctgcttcagagggtgcccagagctcc
ttgcaagaagtttaccacaagtctatgactttgaaagaagccatcaagtcttcactcatc
atcctcaaacaagtaatggaggagaagctgaatgcaacaaacattgagctagccacagtg
cagcctggccagaatttccacatgttcacaaaggaagaacttgaagaggttatcaaggac
atttaa

KEGG   Homo sapiens (human): 5687
Entry
5687              CDS       T01001                                 
Symbol
PSMA6, IOTA, PROS27, p27K
Name
(RefSeq) proteasome 20S subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Disease
H01730  Myocardial infarction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5687 (PSMA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5687 (PSMA6)
   05012 Parkinson disease
    5687 (PSMA6)
   05014 Amyotrophic lateral sclerosis
    5687 (PSMA6)
   05016 Huntington disease
    5687 (PSMA6)
   05017 Spinocerebellar ataxia
    5687 (PSMA6)
   05020 Prion disease
    5687 (PSMA6)
   05022 Pathways of neurodegeneration - multiple diseases
    5687 (PSMA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5687 (PSMA6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5687 (PSMA6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5687 (PSMA6)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5687 (PSMA6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5687 (PSMA6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 5687
NCBI-ProteinID: NP_002782
OMIM: 602855
HGNC: 9535
Ensembl: ENSG00000100902
Pharos: P60900(Tbio)
UniProt: P60900 A0A140VK44
Structure
Position
14:35278558..35317493
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccgtggttccagcgccggttttgaccgccacattaccattttttcacccgagggt
cggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagta
gctgtcagagggaaagactgtgcagtaattgtcacacagaagaaagtacctgacaaatta
ttggattccagcacagtgactcacttattcaagataactgaaaacattggttgtgtgatg
accggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaac
tggaaatacaagtatggctatgagattcctgtggacatgctgtgtaaaagaattgccgat
atttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaggtatataagtgtgatcctgcaggttactac
tgtgggtttaaagccactgcagcgggagttaaacaaactgagtcaaccagcttccttgaa
aaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtg
acagttgaaaatcctaaattcaggattcttacagaagcagagattgatgctcaccttgtt
gctctagcagagagagactaa

KEGG   Homo sapiens (human): 5688
Entry
5688              CDS       T01001                                 
Symbol
PSMA7, C6, HEL-S-276, HSPC, RC6-1, XAPC7
Name
(RefSeq) proteasome 20S subunit alpha 7
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5688 (PSMA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5688 (PSMA7)
   05012 Parkinson disease
    5688 (PSMA7)
   05014 Amyotrophic lateral sclerosis
    5688 (PSMA7)
   05016 Huntington disease
    5688 (PSMA7)
   05017 Spinocerebellar ataxia
    5688 (PSMA7)
   05020 Prion disease
    5688 (PSMA7)
   05022 Pathways of neurodegeneration - multiple diseases
    5688 (PSMA7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5688 (PSMA7)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5688 (PSMA7)
   03051 Proteasome [BR:hsa03051]
    5688 (PSMA7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5688 (PSMA7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5688 (PSMA7)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    5688 (PSMA7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5688 (PSMA7)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Peptidase_C65 DUF5069
Other DBs
NCBI-GeneID: 5688
NCBI-ProteinID: NP_002783
OMIM: 606607
HGNC: 9536
Ensembl: ENSG00000101182
Pharos: O14818(Tbio)
UniProt: O14818 A0A0K0K1K4
Structure
Position
20:complement(62136733..62143394)
AA seq 248 aa
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagctacgaccgcgccatcaccgtcttctcgcccgacggccacctcttccaagtggag
tacgcgcaggaggccgtcaagaagggctcgaccgcggttggtgttcgaggaagagacatt
gttgttcttggtgtggagaagaagtcagtggccaaactgcaggatgaaagaacagtgcgg
aagatctgtgctttggatgacaacgtctgcatggcctttgcaggcctcaccgccgatgca
aggatagtcatcaacagggcccgggtggagtgccagagccaccggctgactgtggaggac
ccggtcactgtggagtacatcacccgctacatcgccagtctgaagcagcgttatacgcag
agcaatgggcgcaggccgtttggcatctctgccctcatcgtgggtttcgactttgatggc
actcctaggctctatcagactgacccctcgggcacataccatgcctggaaggccaatgcc
ataggtcggggtgccaagtcagtgcgcgagttcctggagaagaactatactgacgaagcc
attgaaacagatgatctgaccattaagctggtgatcaaggcactcctggaagtggttcag
tcaggtggcaaaaacattgaacttgctgtcatgaggcgagatcaatccctcaagatttta
aatcctgaagaaattgagaagtatgttgctgaaattgaaaaagaaaaagaagaaaacgaa
aagaagaaacaaaagaaagcatcatga

KEGG   Homo sapiens (human): 5689
Entry
5689              CDS       T01001                                 
Symbol
PSMB1, HC5, PMSB1, PSC5
Name
(RefSeq) proteasome 20S subunit beta 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Drug target
Delanzomib: D10110
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5689 (PSMB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5689 (PSMB1)
   05012 Parkinson disease
    5689 (PSMB1)
   05014 Amyotrophic lateral sclerosis
    5689 (PSMB1)
   05016 Huntington disease
    5689 (PSMB1)
   05017 Spinocerebellar ataxia
    5689 (PSMB1)
   05020 Prion disease
    5689 (PSMB1)
   05022 Pathways of neurodegeneration - multiple diseases
    5689 (PSMB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5689 (PSMB1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5689 (PSMB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5689 (PSMB1)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5689 (PSMB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5689 (PSMB1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1 FAM165
Other DBs
NCBI-GeneID: 5689
NCBI-ProteinID: NP_002784
OMIM: 602017
HGNC: 9537
Ensembl: ENSG00000008018
Pharos: P20618(Tclin)
UniProt: P20618 A0A140VK45
Structure
Position
6:complement(170535120..170553307)
AA seq 241 aa
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgtcctctacagccatgtattcggctcctggcagagacttggggatggaaccgcac
agagccgcgggccctttgcagctgcgattttcgccctacgttttcaacggaggtactata
ctggcaattgctggagaagattttgcaattgttgcttctgatactcgattgagtgaaggg
ttttcaattcatacgcgggatagccccaaatgttacaaattaacagacaaaacagtcatt
ggatgcagcggttttcatggagactgtcttacgctgacaaagattattgaagcaagacta
aagatgtataagcattccaataataaggccatgactacgggggcaattgctgcaatgctg
tctacaatcctgtattcaaggcgcttctttccatactatgtttacaacatcatcggtgga
cttgatgaagaaggaaagggggctgtatacagctttgatccagtagggtcttaccagaga
gactccttcaaggctggaggctcagcaagtgccatgctacagcccctgcttgacaaccag
gttggttttaagaacatgcagaatgtggagcatgttccgctgtccttggacagagccatg
cggctggtgaaagatgtcttcatttctgcggctgagagagatgtgtacactggggacgca
ctccggatctgcatagtgaccaaagagggcatcagggaggaaactgtttccttaaggaag
gactga

KEGG   Homo sapiens (human): 5690
Entry
5690              CDS       T01001                                 
Symbol
PSMB2, HC7-I
Name
(RefSeq) proteasome 20S subunit beta 2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Drug target
Marizomib: D09640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5690 (PSMB2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5690 (PSMB2)
   05012 Parkinson disease
    5690 (PSMB2)
   05014 Amyotrophic lateral sclerosis
    5690 (PSMB2)
   05016 Huntington disease
    5690 (PSMB2)
   05017 Spinocerebellar ataxia
    5690 (PSMB2)
   05020 Prion disease
    5690 (PSMB2)
   05022 Pathways of neurodegeneration - multiple diseases
    5690 (PSMB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5690 (PSMB2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5690 (PSMB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5690 (PSMB2)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5690 (PSMB2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5690 (PSMB2)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 5690
NCBI-ProteinID: NP_002785
OMIM: 602175
HGNC: 9539
Ensembl: ENSG00000126067
Pharos: P49721(Tclin)
UniProt: P49721 A0A140VJS6
Structure
Position
1:complement(35599541..35641526)
AA seq 201 aa
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagtacctcatcggtatccaaggccccgactatgttcttgtcgcctccgaccgggtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aagatattactcctgtgtgttggagaggctggagacactgtacagtttgcagaatatatt
cagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacggcagca
gctaacttcacacgccgaaacctggctgactgtcttcggagtcggaccccatatcatgtg
aacctcctcctggctggctatgatgagcatgaagggccagcgctgtattacatggactac
ctggcagccttggccaaggccccttttgcagcccacggctatggtgccttcctgactctc
agtatcctcgaccgatactacacaccgactatctcacgtgagagggcagtggaactcctt
aggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgtt
cgaatcattgacaaaaatggcatccatgacctggataacatttccttccccaaacagggc
tcctaa

DBGET integrated database retrieval system