KEGG   Homo sapiens (human): 1435Help
Entry
1435              CDS       T01001                                 

Gene name
CSF1, CSF-1, MCSF
Definition
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04668  TNF signaling pathway
hsa05323  Rheumatoid arthritis
Drug target
Linifanib: D09635
Sunitinib (DG00712): D06402 D08552
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1435 (CSF1)
   04015 Rap1 signaling pathway
    1435 (CSF1)
   04010 MAPK signaling pathway
    1435 (CSF1)
   04668 TNF signaling pathway
    1435 (CSF1)
   04151 PI3K-Akt signaling pathway
    1435 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1435 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1435 (CSF1)
  09158 Development
   04380 Osteoclast differentiation
    1435 (CSF1)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    1435 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1435 (CSF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1435 (CSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSF-1
Motif
Other DBs
NCBI-GeneID: 1435
NCBI-ProteinID: NP_000748
OMIM: 120420
HGNC: 2432
Ensembl: ENSG00000184371
Vega: OTTHUMG00000011646
Pharos: P09603(Tbio)
UniProt: P09603 A0A024R0A1
Structure
PDB: 

Position
1p13.3
AA seq 554 aa AA seqDB search
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgggcgccgccgggcgctgccctcccacgacatggctgggctccctgctg
ttgttggtctgtctcctggcgagcaggagtatcaccgaggaggtgtcggagtactgtagc
cacatgattgggagtggacacctgcagtctctgcagcggctgattgacagtcagatggag
acctcgtgccaaattacatttgagtttgtagaccaggaacagttgaaagatccagtgtgc
taccttaagaaggcatttctcctggtacaagacataatggaggacaccatgcgcttcaga
gataacacccccaatgccatcgccattgtgcagctgcaggaactctctttgaggctgaag
agctgcttcaccaaggattatgaagagcatgacaaggcctgcgtccgaactttctatgag
acacctctccagttgctggagaaggtcaagaatgtctttaatgaaacaaagaatctcctt
gacaaggactggaatattttcagcaagaactgcaacaacagctttgctgaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctccatggcccctgtggctggc
ttgacctgggaggactctgagggaactgagggcagctccctcttgcctggtgagcagccc
ctgcacacagtggatccaggcagtgccaagcagcggccacccaggagcacctgccagagc
tttgagccgccagagaccccagttgtcaaggacagcaccatcggtggctcaccacagcct
cgcccctctgtcggggccttcaaccccgggatggaggatattcttgactctgcaatgggc
actaattgggtcccagaagaagcctctggagaggccagtgagattcccgtaccccaaggg
acagagctttccccctccaggccaggagggggcagcatgcagacagagcccgccagaccc
agcaacttcctctcagcatcttctccactccctgcatcagcaaagggccaacagccggca
gatgtaactggtaccgccttgcccagggtgggccccgtgaggcccactggccaggactgg
aatcacaccccccagaagacagaccatccatctgccctgctcagagaccccccggagcca
ggctctcccaggatctcatcactgcgcccccagggcctcagcaacccctccaccctctct
gctcagccacagctttccagaagccactcctcgggcagcgtgctgccccttggggagctg
gagggcaggaggagcaccagggatcggaggagccccgcagagccagaaggaggaccagca
agtgaaggggcagccaggcccctgccccgttttaactccgttcctttgactgacacaggc
catgagaggcagtccgagggatcctccagcccgcagctccaggagtctgtcttccacctg
ctggtgcccagtgtcatcctggtcttgctggccgtcggaggcctcttgttctacaggtgg
aggcggcggagccatcaagagcctcagagagcggattctcccttggagcaaccagagggc
agccccctgactcaggatgacagacaggtggaactgccagtgtag

DBGET integrated database retrieval system