KEGG   Homo sapiens (human): 143503
Entry
143503            CDS       T01001                                 
Symbol
OR51E1, D-GPCR, DGPCR, GPR136, GPR164, OR51E1P, OR52A3P, POGR, PSGR2
Name
(RefSeq) olfactory receptor family 51 subfamily E member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    143503 (OR51E1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    143503 (OR51E1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    143503 (OR51E1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx QCR10
Other DBs
NCBI-GeneID: 143503
NCBI-ProteinID: NP_689643
OMIM: 611267
HGNC: 15194
Ensembl: ENSG00000180785
Pharos: Q8TCB6(Tbio)
UniProt: Q8TCB6 A0A126GVF8
Position
11:4643982..4655488
AA seq 318 aa
MMVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHE
PMYIFLCMLSGIDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLA
MAFDRYVAICHPLRHATVLTLPRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHS
YCLHQDVMKLACDDIRVNVVYGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAF
GTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKE
IRQRILRLFHVATHASEP
NT seq 957 nt   +upstreamnt  +downstreamnt
atgatggtggatcccaatggcaatgaatccagtgctacatacttcatcctaataggcctc
cctggtttagaagaggctcagttctggttggccttcccattgtgctccctctaccttatt
gctgtgctaggtaacttgacaatcatctacattgtgcggactgagcacagcctgcatgag
cccatgtatatatttctttgcatgctttcaggcattgacatcctcatctccacctcatcc
atgcccaaaatgctggccatcttctggttcaattccactaccatccagtttgatgcttgt
ctgctacagatgtttgccatccactccttatctggcatggaatccacagtgctgctggcc
atggcttttgaccgctatgtggccatctgtcacccactgcgccatgccacagtacttacg
ttgcctcgtgtcaccaaaattggtgtggctgctgtggtgcggggggctgcactgatggca
ccccttcctgtcttcatcaagcagctgcccttctgccgctccaatatcctttcccattcc
tactgcctacaccaagatgtcatgaagctggcctgtgatgatatccgggtcaatgtcgtc
tatggccttatcgtcatcatctccgccattggcctggactcacttctcatctccttctca
tatctgcttattcttaagactgtgttgggcttgacacgtgaagcccaggccaaggcattt
ggcacttgcgtctctcatgtgtgtgctgtgttcatattctatgtacctttcattggattg
tccatggtgcatcgctttagcaagcggcgtgactctccgctgcccgtcatcttggccaat
atctatctgctggttcctcctgtgctcaacccaattgtctatggagtgaagacaaaggag
attcgacagcgcatccttcgacttttccatgtggccacacacgcttcagagccctag

DBGET integrated database retrieval system