KEGG   Homo sapiens (human): 1436Help
Entry
1436              CDS       T01001                                 

Gene name
CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00116  Mutation-inactivated RUNX1 to transcription
Disease
H00028  Choriocarcinoma
H01807  Hereditary diffuse leukoencephalopathy with spheroids
Drug target
Edicotinib (DG03000): D11378 D11379
Emactuzumab: D11234
Mirimostim: D02664
Pexidartinib (DG02960): D11270 D11271
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1436 (CSF1R)
   04015 Rap1 signaling pathway
    1436 (CSF1R)
   04010 MAPK signaling pathway
    1436 (CSF1R)
   04151 PI3K-Akt signaling pathway
    1436 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1436 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1436 (CSF1R)
  09158 Development
   04380 Osteoclast differentiation
    1436 (CSF1R)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1436 (CSF1R)
   05202 Transcriptional misregulation in cancer
    1436 (CSF1R)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    1436 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1436 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1436 (CSF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1436 (CSF1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   1436 (CSF1R)
CD molecules [BR:hsa04090]
 Proteins
  1436 (CSF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig Ig_2 I-set Izumo-Ig C2-set_2
Motif
Other DBs
NCBI-GeneID: 1436
NCBI-ProteinID: NP_001275634
OMIM: 164770
HGNC: 2433
Ensembl: ENSG00000182578
Vega: OTTHUMG00000130050
Pharos: P07333(Tclin)
UniProt: P07333
Structure
PDB: 

Position
5q32
AA seq 972 aa AA seqDB search
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttg
cgatgtgtgggcaatggcagcgtggaatgggatggccccccatcacctcactggaccctg
tactctgatggctccagcagcatcctcagcaccaacaacgctaccttccaaaacacgggg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctat
gtcaaagaccctgcccggccctggaacgtgctagcacaggaggtggtcgtgttcgaggac
caggacgcactactgccctgtctgctcacagacccggtgctggaagcaggcgtctcgctg
gtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcat
ggcttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcagcgttgatgttaactttgatgtcttcctccaacacaac
aacaccaagctcgcaatccctcaacaatctgactttcataataaccgttaccaaaaagtc
ctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctac
ttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcccaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagagctctgacgtttgagctcacccttcgatac
cccccagaggtaagcgtcatatggacattcatcaacggctctggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgatagg
tgtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccag
gagcccttccacaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaac
caaacctacgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccacacgcatcccccggatgagttcctcttcacaccagtggtggtc
gcctgcatgtccatcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacg
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaggaggccctcatgtccgagctgaagatcatgagccacctg
ggccagcacgagaacatcgtcaaccttctgggagcctgtacccatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccccggccaggaccccgagggaggcgtcgactataag
aacatccacctcgagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggca
gcgcgtaacgtgctgttgaccaatggtcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacattgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccaccttccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagag
cgggactataccaatctgccgagcagcagcagaagcggtggcagcggcagcagcagcagt
gagctggaggaggagagctctagtgagcacctgacctgctgcgagcaaggggatatcgcc
cagcccttgctgcagcccaacaactatcagttctgctga

DBGET integrated database retrieval system