KEGG   Homo sapiens (human): 1436Help
Entry
1436              CDS       T01001                                 

Gene name
CSF1R, BANDDOS, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
Disease
H00028  Choriocarcinoma
H01807  Hereditary diffuse leukoencephalopathy with spheroids
Drug target
Edicotinib (DG03000): D11378 D11379
Emactuzumab: D11234
Mirimostim: D02664
Pexidartinib (DG02960): D11270 D11271
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1436 (CSF1R)
   04015 Rap1 signaling pathway
    1436 (CSF1R)
   04010 MAPK signaling pathway
    1436 (CSF1R)
   04151 PI3K-Akt signaling pathway
    1436 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1436 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1436 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1436 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1436 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1436 (CSF1R)
   05202 Transcriptional misregulation in cancer
    1436 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1436 (CSF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1436 (CSF1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   1436 (CSF1R)
CD molecules [BR:hsa04090]
 Proteins
  1436 (CSF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig Ig_2 I-set Izumo-Ig C2-set_2
Motif
Other DBs
NCBI-GeneID: 1436
NCBI-ProteinID: NP_001275634
OMIM: 164770
HGNC: 2433
Ensembl: ENSG00000182578
Vega: OTTHUMG00000130050
Pharos: P07333(Tclin)
UniProt: P07333
Structure
PDB: 

Position
5q32
AA seq 972 aa AA seqDB search
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttg
cgatgtgtgggcaatggcagcgtggaatgggatggccccccatcacctcactggaccctg
tactctgatggctccagcagcatcctcagcaccaacaacgctaccttccaaaacacgggg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctat
gtcaaagaccctgcccggccctggaacgtgctagcacaggaggtggtcgtgttcgaggac
caggacgcactactgccctgtctgctcacagacccggtgctggaagcaggcgtctcgctg
gtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcat
ggcttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcagcgttgatgttaactttgatgtcttcctccaacacaac
aacaccaagctcgcaatccctcaacaatctgactttcataataaccgttaccaaaaagtc
ctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctac
ttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcccaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagagctctgacgtttgagctcacccttcgatac
cccccagaggtaagcgtcatatggacattcatcaacggctctggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgatagg
tgtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccag
gagcccttccacaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaac
caaacctacgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccacacgcatcccccggatgagttcctcttcacaccagtggtggtc
gcctgcatgtccatcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacg
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaggaggccctcatgtccgagctgaagatcatgagccacctg
ggccagcacgagaacatcgtcaaccttctgggagcctgtacccatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccccggccaggaccccgagggaggcgtcgactataag
aacatccacctcgagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggca
gcgcgtaacgtgctgttgaccaatggtcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacattgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccaccttccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagag
cgggactataccaatctgccgagcagcagcagaagcggtggcagcggcagcagcagcagt
gagctggaggaggagagctctagtgagcacctgacctgctgcgagcaaggggatatcgcc
cagcccttgctgcagcccaacaactatcagttctgctga

DBGET integrated database retrieval system