KEGG   Homo sapiens (human): 143630
Entry
143630            CDS       T01001                                 

Symbol
UBQLNL
Name
(RefSeq) ubiquilin like
  KO
K22254  ubiquilin-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    143630 (UBQLNL)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    143630 (UBQLNL)
SSDB
Motif
Pfam: ubiquitin MNE1 YukD Rad60-SLD
Other DBs
NCBI-GeneID: 143630
NCBI-ProteinID: NP_659490
HGNC: 28294
Ensembl: ENSG00000175518
Vega: OTTHUMG00000066903
Pharos: Q8IYU4(Tdark)
UniProt: Q8IYU4
Position
11p15.4
AA seq 475 aa
MWHAISRTSRMSQSGCPSGLLADKNISSSATRVIVKTAGNQKDFMVADDISVRQFKEMLL
AHFQCQMDQLVLVFMGCLLKDHDTLSQRGIMDGHTIYLVIKSKQGSRSLAHSFRDLPTND
PCHRDRNTKGNSSRVHQPTGMNQAPVELAHFVGSDAPKVHTQNLEVSHPECKAQMLENPS
IQRLLSNMEFMWQFISEHLDTQQLMQQNPEVSRLLLDNSEILLQTLELARNLAMIQEIMQ
IQQPSQNLEYPLNPQPYLGLETMPGGNNALGQNYADINDQMLNSMQDPFGGNPFTALLAG
QVLEQVQSSPPPPPPSQEQQDQLTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANT
AMISTKGQSHICATRQPAWIPALPSIELTQQLQEEYKDATVSLSSSRQTLKGDLQLSDEQ
SSSQITGGMMQLLMNNPYLAAQIMLFTSMPQLSEQWRQQLPTFLQQTQISDLLSA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtggcatgccatctctcgaacatccaggatgtcccagagtggatgtccatcaggtctg
ctggcagacaaaaatatctcttcaagtgccactcgagtgatagtgaagactgcaggcaac
cagaaagactttatggtagctgatgacatctcggtaaggcagttcaaggagatgctattg
gctcacttccaatgccagatggaccaactagtgctggtcttcatgggttgccttctcaaa
gaccatgacacactgagccagaggggcatcatggatggccacaccatctacttggtcatc
aagtccaagcagggctccagatctctagcccattccttccgggacctgccaacgaatgat
ccctgccaccgggacagaaacaccaaaggaaacagcagcagagtgcaccaaccaactggt
atgaatcaagctccagtggaactggcccactttgtggggtctgatgcacccaaagtgcat
acccaaaacttggaagtgagccacccagagtgcaaagcacagatgctggagaatcctagc
atccagcggcttctgtccaacatggagttcatgtggcagttcatttcagaacatctagac
acgcaacaattgatgcagcagaacccagaagtttcccgccttcttcttgataattctgag
atcctattgcagactctggagctggccaggaaccttgctatgatccaagagataatgcag
atccaacaaccttcacaaaaccttgagtatccactgaacccacagccatatctgggctta
gagacaatgccaggtgggaataatgccctgggtcagaactatgctgatatcaatgatcaa
atgctgaacagcatgcaagatccttttggaggaaaccctttcacagctctcctggcagga
caagtgctagaacaagtccagtcttcacccccacctccaccaccatcacaggaacaacaa
gaccagctcacacagcatcctgcaacccgagtcatctataatagctctggtggtttctct
tcaaacacctcagccaatgacacccttaacaaggtcaaccacacttccaaagccaacact
gctatgatttccaccaagggccagagccatatctgtgccactcggcagccagcttggata
ccagccttacctagcatagagcttacccagcagcttcaagaagaatacaaggatgccact
gtttctctaagtagctccagacagacattaaagggtgatctccagctgtcagatgagcag
agcagctcccagatcacaggaggcatgatgcagttgcttatgaacaacccctacctggca
gctcagattatgttgttcacaagtatgccccagctgagtgaacagtggaggcagcagctg
cccacattcctgcagcagacacagatttctgatctgcttagtgcttag

KEGG   Homo sapiens (human): 29978
Entry
29978             CDS       T01001                                 

Symbol
UBQLN2, ALS15, CHAP1, DSK2, HRIHFB2157, N4BP4, PLIC2
Name
(RefSeq) ubiquilin 2
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
Network
nt06420  Ubiquitin-proteasome system
nt06464  Amyotrophic lateral sclerosis
  Element
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29978 (UBQLN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29978 (UBQLN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29978 (UBQLN2)
   03051 Proteasome [BR:hsa03051]
    29978 (UBQLN2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29978 (UBQLN2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29978 (UBQLN2)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 Ubiquitin_5 DUF2407 Atg8 CUE
Other DBs
NCBI-GeneID: 29978
NCBI-ProteinID: NP_038472
OMIM: 300264
HGNC: 12509
Ensembl: ENSG00000188021
Vega: OTTHUMG00000021669
Pharos: Q9UHD9(Tbio)
UniProt: Q9UHD9
Structure
PDB: 
6MUN 2NBV 1J8C

Position
Xp11.21
AA seq 624 aa
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggctgagaatggcgagagcagcggccccccgcgcccctcccgcggccctgctgcggcc
caaggctcggctgctgccccggctgagcctaaaatcatcaaagtcacggtgaagactccc
aaagagaaagaggagttcgcggtgcccgagaacagctcggttcagcagtttaaggaagcg
atttcgaaacgcttcaaatcccaaaccgatcagctagtgctgatttttgccggaaaaatc
ttaaaagatcaagataccttgatccagcatggcatccatgatgggctgactgttcacctt
gtcatcaaaagccagaaccgacctcagggccagtccacgcagcctagcaatgccgcggga
actaacactacctcggcgtcgactcccaggagtaactccacacctatttccacaaatagc
aacccgtttgggttggggagcctgggaggacttgcaggccttagcagcctgggcttgagc
tcgaccaacttctctgagctccagagccagatgcagcagcagcttatggccagccctgag
atgatgatccaaataatggaaaatccctttgttcagagcatgctttcgaatcccgatctg
atgaggcagctcattatggctaatccacagatgcagcaattgattcagagaaacccagaa
atcagtcacctgctcaacaacccagacataatgaggcagacactcgaaattgccaggaat
ccagccatgatgcaagagatgatgagaaatcaagacctggctcttagcaatctagaaagc
atcccaggtggctataatgctttacggcgcatgtacactgacattcaagagccgatgctg
aatgccgcacaagagcagtttgggggtaatccatttgcctccgtggggagtagttcctcc
tctggggaaggtacgcagccttcccgcacagaaaatcgcgatccactacccaatccatgg
gcaccaccgccagctacccagagttctgcaactaccagcacgaccacaagcactggtagt
gggtctggcaatagttccagcaatgctactgggaacaccgttgctgccgctaattatgtc
gccagcatctttagtaccccaggcatgcagagcctgctgcaacagataactgaaaacccc
cagctgattcagaatatgctgtcggcgccctacatgagaagcatgatgcagtcgctgagc
cagaatccagatttggctgcacagatgatgctgaatagcccgctgtttactgcaaatcct
cagctgcaggagcagatgcggccacagctcccagccttcctgcagcagatgcagaatcca
gacacactatcagccatgtcaaacccaagagcaatgcaggctttaatgcagatccagcag
gggctacagacattagccactgaagcacctggcctgattccgagcttcactccaggtgtg
ggggtgggggtgctgggaaccgctataggccctgtaggcccagtcacccccataggcccc
ataggccctatagtcccttttacccccataggccccattgggcccataggacccactggc
cctgcagccccccctggctccaccggctctggtggccccacggggcctactgtgtccagc
gctgcacctagtgaaaccacgagtcctacatcagaatctggacccaaccagcagttcatt
cagcaaatggtgcaggccctggctggagcaaatgctccacagctgccgaatccagaagtc
agatttcagcaacaactggaacagctcaacgcaatggggttcttaaaccgtgaagcaaac
ttgcaggccctaatagcaacaggaggcgacatcaatgcagccattgaaaggctgctgggc
tcccagccatcgtaa

KEGG   Homo sapiens (human): 29979
Entry
29979             CDS       T01001                                 

Symbol
UBQLN1, DA41, DSK2, PLIC-1, UBQN, XDRP1
Name
(RefSeq) ubiquilin 1
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29979 (UBQLN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29979 (UBQLN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29979 (UBQLN1)
   03051 Proteasome [BR:hsa03051]
    29979 (UBQLN1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    29979 (UBQLN1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29979 (UBQLN1)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 Ubiquitin_5 DUF2407 CUE Atg8
Other DBs
NCBI-GeneID: 29979
NCBI-ProteinID: NP_038466
OMIM: 605046
HGNC: 12508
Ensembl: ENSG00000135018
Vega: OTTHUMG00000020104
Pharos: Q9UMX0(Tbio)
UniProt: Q9UMX0
Structure
PDB: 
2KLC 2JY5 2JY6

Position
9q21.32; 9q21.2-q21.3
AA seq 589 aa
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccgagagtggtgaaagcggcggtcctccgggctcccaggatagcgccgccggagcc
gaaggtgctggcgcccccgcggccgctgcctccgcggagcccaaaatcatgaaagtcacc
gtgaagaccccgaaggaaaaggaggaattcgccgtgcccgagaatagctccgtccagcag
tttaaggaagaaatctctaaacgttttaaatcacatactgaccaacttgtgttgatattt
gctggaaaaattttgaaagatcaagataccttgagtcagcatggaattcatgatggactt
actgttcaccttgtcattaaaacacaaaacaggcctcaggatcattcagctcagcaaaca
aatacagctggaagcaatgttactacatcatcaactcctaatagtaactctacatctggt
tctgctactagcaacccttttggtttaggtggccttgggggacttgcaggtctgagtagc
ttgggtttgaatactaccaacttctctgaactacagagtcagatgcagcgacaacttttg
tctaaccctgaaatgatggtccagatcatggaaaatccctttgttcagagcatgctctca
aatcctgacctgatgagacagttaattatggccaatccacaaatgcagcagttgatacag
agaaatccagaaattagtcatatgttgaataatccagatataatgagacaaacgttggaa
cttgccaggaatccagcaatgatgcaggagatgatgaggaaccaggaccgagctttgagc
aacctagaaagcatcccagggggatataatgctttaaggcgcatgtacacagatattcag
gaaccaatgctgagtgctgcacaagagcagtttggtggtaatccatttgcttccttggtg
agcaatacatcctctggtgaaggtagtcaaccttcccgtacagaaaatagagatccacta
cccaatccatgggctccacagacttcccagagttcatcagcttccagcggcactgccagc
actgtgggtggcactactggtagtactgccagtggcacttctgggcagagtactactgcg
ccaaatttggtgcctggagtaggagctagtatgttcaacacaccaggaatgcagagcttg
ttgcaacaaataactgaaaacccacaactgatgcaaaacatgttgtctgccccctacatg
agaagcatgatgcagtcactaagccagaatcctgaccttgctgcacagatgatgctgaat
aatcccctatttgctggaaatcctcagcttcaagaacaaatgagacaacagctcccaact
ttcctccaacaaatgcagaatcctgatacactatcagcaatgtcaaaccctagagcaatg
caggccttgttacagattcagcagggtttacagacattagcaacggaagccccgggcctc
atcccagggtttactcctggcttgggggcattaggaagcactggaggctcttcgggaact
aatggatctaacgccacacctagtgaaaacacaagtcccacagcaggaaccactgaacct
ggacatcagcagtttattcagcagatgctgcaggctcttgctggagtaaatcctcagcta
cagaatccagaagtcagatttcagcaacaactggaacaactcagtgcaatgggatttttg
aaccgtgaagcaaacttgcaagctctaatagcaacaggaggtgatatcaatgcagctatt
gaaaggttactgggctcccagccatcatag

KEGG   Homo sapiens (human): 50613
Entry
50613             CDS       T01001                                 

Symbol
UBQLN3, TUP-1
Name
(RefSeq) ubiquilin 3
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50613 (UBQLN3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    50613 (UBQLN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50613 (UBQLN3)
   03051 Proteasome [BR:hsa03051]
    50613 (UBQLN3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    50613 (UBQLN3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    50613 (UBQLN3)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Rad60-SLD_2 DUF2407 YukD Ubiquitin_5 HOIP-UBA ExbD
Other DBs
NCBI-GeneID: 50613
NCBI-ProteinID: NP_001334025
OMIM: 605473
HGNC: 12510
Ensembl: ENSG00000175520
Vega: OTTHUMG00000066886
Pharos: Q9H347(Tbio)
UniProt: Q9H347 A0A140VJZ3
Structure
PDB: 
1YQB 2DAH 1WX7

Position
11p15.4
AA seq 655 aa
MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQP
SSIYPADGPPAFSLGLLTGLSRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMIRSQDRV
LSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCD
PLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLHENPQSLGTYL
QGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSP
AYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPR
LLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQ
DLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLRQS
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccaaaggtggagaagccctgccacagggcagcccagcaccagtccaggatccccac
ctcatcaaggtgacagtgaagacgcccaaagacaaggaggatttctcagttacagacaca
tgcactatccagcagctgaaggaagagatatctcagcgctttaaggcccaccccgatcag
cttgttctaatctttgctggcaaaatcctcaaggatcctgactcactggcacagtgtgga
gtgcgagatggcctcactgtccacctggtcatcaagaggcagcaccgtgccatgggcaat
gagtgcccagctgcctctgtccctacccagggcccaagtcctggatcactccctcagcca
agctccatttacccagcagatgggccccctgcctttagcttaggtctcctcacaggcctc
agtaggctgggcttggcctatcgtggcttccctgaccagccaagctccctgatgcggcag
catgtgtctgtgcctgagtttgtgactcagctcattgatgaccccttcatcccgggtctg
ctgtccaacacaggcctagtacgccagctggttcttgacaacccccatatgcagcagctg
atccagcacaaccctgagattgggcatattcttaacaacccggaaattatgcggcagaca
ctggagtttttacgtaaccctgccatgatgcaggagatgatacgtagccaggaccgggtg
ctcagtaacttggagagcattcctggtggctacaatgtgctttgcactatgtacacagat
attatggacccaatgcttaacgcagtccaggagcagtttggcggcaatccctttgccact
gccactactgataatgccaccaccaccaccagccaaccttcaaggatggagaattgtgac
cctctccccaacccctggacttccacacatggaggctcaggtagcaggcaaggaaggcag
gatggggatcaggatgcacctgacattagaaataggtttccaaactttctgggtattata
aggctctatgactatctccagcaattacacgagaacccccagtccctaggaacttatcta
caggggactgcatctgccctcagccaaagccaggaaccaccaccatcagtaaacagagtt
cccccatcgtcaccctcatctcaggagcctgggtcaggccagcctctccccgaggagtca
gtagcaatcaagggaaggtcctcctgcccagctttcctgagataccccacagagaacagt
actggacaaggtggagaccaagatggtgcagggaaaagctctactggacatagcacaaac
ttgcctgatcttgtctcggggctgggagattctgccaacagggttccatttgctccctta
tctttttcccccacggcagccattcctggaatccctgagcctccctggctgccatccccg
gcttatccaagatctctgaggccagatggcatgaatccagctccacagttacaggatgag
atacaaccacagctgccactgctgatgcaccttcaggcagccatggcaaacccccgtgcc
ctgcaagccctgcggcagattgagcagggtctacaggtcctagctactgaagcacctcgc
ctcctactctggttcatgccttgcctagcagggacgggtagtgtggcaggaggtatagag
tctagagaagatccccttatgtctgaggatcctctcccaaatccacctcctgaggtgttc
ccagcactggactctgcagagctgggcttcctttcccctccctttctccatatgctgcaa
gatttagttagtacaaatccccagcagctgcagcctgaggctcactttcaggtgcagctg
gagcaactgcggtccatgggctttctgaatcgtgaagccaatcttcaggccctcattgct
acggggggcgacgtggatgctgctgtggagaagctgagacagtcgtag

KEGG   Homo sapiens (human): 56893
Entry
56893             CDS       T01001                                 

Symbol
UBQLN4, A1U, A1Up, C1orf6, CIP75, UBIN
Name
(RefSeq) ubiquilin 4
  KO
K04523  ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56893 (UBQLN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    56893 (UBQLN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56893 (UBQLN4)
   03051 Proteasome [BR:hsa03051]
    56893 (UBQLN4)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    56893 (UBQLN4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    56893 (UBQLN4)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Ubiquitin_5 YukD Rad60-SLD_2 DUF2407 CUE HOIP-UBA Arm_2
Other DBs
NCBI-GeneID: 56893
NCBI-ProteinID: NP_064516
OMIM: 605440
HGNC: 1237
Ensembl: ENSG00000160803
Vega: OTTHUMG00000017461
Pharos: Q9NRR5(Tbio)
UniProt: Q9NRR5
Position
1q22
AA seq 601 aa
MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQ
PSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGISRTPAPSAGSNAGSTPEAPTSSPATPATSSPTGASSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcggagccgagcggggccgagacgaggccccccattcgggtcaccgtcaagaccccc
aaggacaaggaggaaattgtgatctgcgatcgagcctcggtcaaggagttcaaagaggaa
atctcccggaggtttaaggctcagcaggatcagctggtcctgatcttcgcaggcaagatc
ctcaaggatggggacacactgaaccagcacggaatcaaggacgggctcactgtccatctg
gtcatcaagacccctcagaaggctcaagatccagctgctgccactgcttcttccccctcc
acacctgaccctgcctcagcaccctccaccacgcctgcttcacccgccacccctgcccag
ccctccacctctggcagtgcctcttcagatgctggcagtggaagccggaggagcagtggt
ggggggccctctccgggggctggggagggatcccccagtgctactgcgtccatactctct
ggctttgggggcatcctggggctgggcagcctaggcctgggctctgccaacttcatggag
ctgcagcagcagatgcagcggcagctgatgtccaatcctgagatgctgtcacagatcatg
gagaaccccctggtccaggatatgatgtctaaccctgatctgatgcgtcacatgattatg
gccaacccccagatgcagcagttgatggagcggaaccctgagatcagccacatgctcaat
aaccctgaactcatgaggcagacaatggagcttgctcggaatccagccatgatgcaagag
atgatgcggaaccaggaccgggccctgagcaaccttgagagcatccctggagggtataat
gccctccgccgcatgtacacggacatccaggagcccatgttcagtgctgcccgggaacag
tttggcaacaatcccttctcttccctggccgggaactccgacagctcatcctcccagcct
ctgcggactgagaatcgagagcccctccctaacccctggagcccctcgccccccacctcc
caggcccccgggtccggtggggagggcaccggaggatcggggaccagccaggtgcacccg
acagtctcgaacccctttgggatcaatgcggctagcctggggtcagggatgttcaatagc
ccagaaatgcaagccctcctccagcagatctctgagaacccccagctgatgcagaatgtg
atctcagcaccctacatgcgcagcatgatgcagacgcttgcccagaaccccgactttgct
gctcagatgatggtgaatgtgccgctcttcgcggggaacccccaactgcaggagcagctc
cgcctgcagctcccagtcttcctgcagcagatgcagaacccagagtcactctccatcctt
accaatccccgagccatgcaggcattgctgcagatccagcagggactacagaccttgcag
accgaggcccctgggctggtacccagccttggctcctttgggatatcccggaccccagca
ccctcagcaggcagcaacgcagggtctacgcccgaggcccccacttcctcaccagccacg
ccagccacatcttctccaacaggggcttccagcgcccagcagcaactcatgcagcagatg
atccagcttttggctggaagtggaaactcacaggtgcagacgccagaagtgagatttcag
cagcagctggagcagctcaactccatgggcttcatcaatcgtgaggctaacctgcaggcc
ctgattgccacaggaggggacatcaacgcagctatcgagagactgctgggctcccagctc
tcctaa

DBGET integrated database retrieval system