KEGG   Homo sapiens (human): 143662Help
Entry
143662            CDS       T01001                                 

Gene name
MUC15, MUC-15, PAS3, PASIII
Definition
(RefSeq) mucin 15, cell surface associated
  KO
K22019  mucin-15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    143662 (MUC15)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    143662 (MUC15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mucin15 Rick_17kDa_Anti
Motif
Other DBs
NCBI-GeneID: 143662
NCBI-ProteinID: NP_663625
OMIM: 608566
HGNC: 14956
Ensembl: ENSG00000169550
Vega: OTTHUMG00000166112
Pharos: Q8N387(Tbio)
UniProt: Q8N387
Position
11p14.2
AA seq 334 aa AA seqDB search
MLALAKILLISTLFYSLLSGSHGKENQDINTTQNIAEVFKTMENKPISLESEANLNSDKE
NITTSNLKASHSPPLNLPNNSHGITDFSSNSSAEHSLGSLKPTSTISTSPPLIHSFVSKV
PWNAPIADEDLLPISAHPNATPALSSENFTWSLVNDTVKTPDNSSITVSILSSEPTSPSV
TPLIVEPSGWLTTNSDSFTGFTPYQEKTTLQPTLKFTNNSKLFPNTSDPQKENRNTGIVF
GAILGAILGVSLLTLVGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSS
YYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttggccttagccaaaattctgttgatttcaacgttgttttattcacttctatcgggg
agccatggaaaagaaaatcaagacataaacacaacacagaacattgcagaagtttttaaa
acaatggaaaataaacctatttctttggaaagtgaagcaaacttaaactcagataaagaa
aatataaccacctcaaatctcaaggcgagtcattcccctcctttgaatctacccaacaac
agccacggaataacagatttctccagtaactcatcagcagagcattctttgggcagtcta
aaacccacatctaccatttccacaagccctcccttgatccatagctttgtttctaaagtg
ccttggaatgcacctatagcagatgaagatcttttgcccatctcagcacatcccaatgct
acacctgctctgtcttcagaaaacttcacttggtctttggtcaatgacaccgtgaaaact
cctgataacagttccattacagttagcatcctctcttcagaaccaacttctccatctgtg
acccccttgatagtggaaccaagtggatggcttaccacaaacagtgatagcttcactggg
tttaccccttatcaagaaaaaacaactctacagcctaccttaaaattcaccaataattca
aaactctttccaaatacgtcagatccccaaaaagaaaatagaaatacaggaatagtattc
ggggccattttaggtgctattctgggtgtctcattgcttactcttgtgggctacttgttg
tgtggaaaaaggaaaacggattcattttcccatcggcgactttatgacgacagaaatgaa
ccagttctgcgattagacaatgcaccggaaccttatgatgtgagttttgggaattctagc
tactacaatccaactttgaatgattcagccatgccagaaagtgaagaaaatgcacgtgat
ggcattcctatggatgacatacctccacttcgtacttctgtatag

DBGET integrated database retrieval system