KEGG   Homo sapiens (human): 143686
Entry
143686            CDS       T01001                                 

Gene name
SESN3, SEST3
Definition
(RefSeq) sestrin 3
  KO
K10141  sestrin 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    143686 (SESN3)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    143686 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11
Other DBs
NCBI-GeneID: 143686
NCBI-ProteinID: NP_653266
OMIM: 607768
HGNC: 23060
Ensembl: ENSG00000149212
Vega: OTTHUMG00000167829
Pharos: P58005(Tbio)
UniProt: P58005
Position
11q21
AA seq 492 aa
MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTN
FLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQ
CSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKT
GENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLAND
NNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFV
VSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHG
FSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDY
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAEL
LYALRAITRHLT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaaccggggcggcggcagcccgtcggccgccgccaactacctgctctgtaccaactgc
cggaaagtgctgcggaaggataaaagaatcagagtgtctcaacccttgacaagaggacca
agtgcctttattccagagaaggaagttgtccaagcaaacacagtggatgaacgtactaac
tttcttgtggaagaatactctacatccggtcgtctggacaacatcacacaggtcatgagt
ttacacactcagtacctggagtctttcttgcggagccagttttacatgttgcgcatggat
ggtccccttcctctaccatacaggcactatattgcaataatggctgcagctagacatcag
tgttcttacttaataaacatgcatgtggatgaatttttaaagactggaggtattgctgag
tggttgaatggtttggaatatgtgccacaaagactgaaaaatcttaatgaaattaataag
ctgctagcacatcgaccttggctgatcacaaaagagcacattcagaaacttgtcaaaact
ggagaaaataattggtctctgcctgaactggtacatgctgtggtcctcctggcacattat
catgctttggcaagctttgtttttggtagtggtatcaatccagagagagatccagaaatc
tccaatggattcaggctaatatcagtcaacaatttctgcgtttgtgatcttgctaatgac
aacaacatagagaatgcatctctttcaggcagcaactttgggattgtggattctctaagt
gagctagaggccttaatggaaaggatgaaaagacttcaagaagaaagggaagatgaagag
gcgtctcaagaagaaatgagcactcgttttgaaaaggagaagaaagaaagtctttttgtg
gtctctggagatacttttcattcatttcctcattcagattttgaggatgacatgattata
acatctgatgtctctcgatatattgaagaccctggttttgggtatgaagactttgccaga
cgaggagaagagcatttgccaacattccgagctcaggactatacctgggaaaatcatggg
ttctccctggtgaacagactttattctgacattggacatcttcttgatgaaaagtttcgg
atggtctacaatctcacatataacactatggccacccatgaggatgttgacacaaccatg
ctgcgcagagctttatttaactatgttcactgtatgtttggaatcaggtatgatgactat
gattatggagaagttaatcaattacttgaaagaagcctgaaggtttacattaagacagtg
acctgctatcctgagagaactacaaaacgcatgtatgatagttactggcggcagttcaaa
cactcagaaaaagttcatgtcaatctacttttaatggaagcacgaatgcaagctgaactt
ctttatgctcttcgtgccataactcggcatttgacctga

KEGG   Homo sapiens (human): 27244
Entry
27244             CDS       T01001                                 

Gene name
SESN1, PA26, SEST1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    27244 (SESN1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    27244 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 27244
NCBI-ProteinID: NP_001186862
OMIM: 606103
HGNC: 21595
Ensembl: ENSG00000080546
Vega: OTTHUMG00000015338
Pharos: Q9Y6P5(Tbio)
UniProt: Q9Y6P5
Position
6q21
AA seq 492 aa
MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQV
GSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYI
GIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITK
EHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSN
YCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASR
FEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHG
YSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAEL
LYALRAITRYMT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcgcttggccgccgccgcgaacgaggcgtacacggcccctttggcggtctcggggctg
ctgggctgcaagcagtgcggcgggggccgcgaccaggacgaggaacttggcattagaatt
cctcgaccactaggacagggaccaagcagattcatcccagaaaaggagatcctccaagtg
gggagtgaagacgcacagatgcatgctttatttgcagattcttttgctgctttgggccgt
ttggataacattacgttagtgatggttttccacccacaatatttagaaagtttcttaaaa
actcagcactatctactgcaaatggatgggccgttacccctacattatcgtcactacatt
ggaataatggctgcggcaagacatcagtgctcctacttagtgaacctgcatgtaaatgat
ttccttcatgttggtggggaccccaagtggctcaatggtttagagaatgctcctcaaaaa
ctacagaatttaggagaacttaacaaagtgttagcccatagaccttggcttattaccaaa
gaacacattgagggacttttaaaagctgaagagcacagctggtcccttgcggaattggta
catgcagtagttttactcacacactatcattctcttgcctcattcacattcggctgtgga
atcagtccagaaattcattgtgatggtggccacacattcagacctccttctgttagcaac
tactgcatctgtgacattacaaatggcaatcacagtgtggatgagatgccggtcaactca
gcagaaaatgtttctgtaagtgattctttctttgaggttgaagccctcatggaaaagatg
aggcagttacaggaatgtcgagatgaagaagaggcaagtcaggaagagatggcttcacgt
tttgaaatagaaaaaagagagagtatgtttgtcttctcttcagatgatgaagaagttaca
ccagcaagagctgtatctcgtcattttgaggatactagttatggctataaagatttctct
agacatgggatgcatgttccaacatttcgtgtccaggactattgctgggaagatcatggt
tattctttggtaaatcgcctttatccagatgtgggacagttgattgatgaaaaatttcac
attgcttacaatcttacttataatacaatggcaatgcacaaagatgttgatacctcaatg
cttagacgggcaatttggaactatattcactgcatgtttggaataagatatgatgattat
gactatggtgaaattaaccagctattggatcgtagctttaaagtttatatcaaaactgtt
gtttgcactcctgaaaaggttaccaaaagaatgtatgatagcttctggaggcagttcaag
cactctgagaaggttcatgttaatctgcttcttatagaagctaggatgcaagcagaactc
ctttatgctctgagagccattacccgctatatgacctga

KEGG   Homo sapiens (human): 83667
Entry
83667             CDS       T01001                                 

Gene name
SESN2, HI95, SES2, SEST2
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    83667 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    83667 (SESN2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    83667 (SESN2)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 83667
NCBI-ProteinID: NP_113647
OMIM: 607767
HGNC: 20746
Ensembl: ENSG00000130766
Vega: OTTHUMG00000003532
Pharos: P58004(Tbio)
UniProt: P58004
Structure
PDB: 
5DJ4 5T0N 6N0M 5CUF

Position
1p35.3
AA seq 480 aa
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgatcgtggcggactccgagtgccgcgcagagctcaaggactacctgcggttcgccccg
ggcggcgtcggcgactcgggccccggagaggagcagagggagagccgggctcggcgaggc
cctcgagggcccagcgccttcatccccgtggaggaggtccttcgggagggggctgagagc
ctcgagcagcacctggggctggaggcactgatgtcctctgggcgagtagacaacctggca
gtggtgatgggcctgcaccctgactactttaccagcttctggcgcctgcactacctgctg
ctgcacacggatggtcccttggccagctcctggcgccactacattgccatcatggctgcc
gcccgccatcagtgttcttacctggtaggctcccacatggccgagtttctgcagactggt
ggtgaccctgagtggctgctgggcctccaccgggcccccgagaagctgcgcaaactcagc
gagatcaacaagttgctggcgcatcggccatggctcatcaccaaggaacacatccaggcc
ttgctgaagaccggcgagcacacttggtccctggccgagctcattcaggctctggtcctg
ctcacccactgccactcgctctcctccttcgtgtttggctgtggcatcctccctgagggg
gatgcagatggcagccctgccccccaggcacctacaccccctagtgaacagagcagcccc
ccaagcagggacccgttgaacaactctgggggctttgagtctgcccgcgacgtggaggcg
ctgatggagcgcatgcagcagctgcaggagagcctgctgcgggatgaggggacgtcccag
gaggagatggagagccgctttgagctggagaagtcagagagcctgctggtgaccccctca
gctgacatcctggagccctctccacacccagacatgctgtgctttgtggaagaccctact
ttcggatatgaggacttcactcggagaggggctcaggcaccccctaccttccgggcccag
gattatacctgggaagaccatggctactcgctgatccagcggctttaccctgagggtggg
cagctgctggatgagaagttccaggcagcctatagcctcacctacaataccatcgccatg
cacagtggtgtggacacctccgtgctccgcagggccatctggaactatatccactgcgtc
tttggcatcagatatgatgactatgattatggggaggtgaaccagctcctggagcggaac
ctcaaggtctatatcaagacagtggcctgctacccagagaagaccacccgaagaatgtac
aacctcttctggaggcacttccgccactcagagaaggtccacgtgaacttgctgctcctg
gaggcgcgcatgcaagccgctctgctgtacgccctccgtgccatcacccgctacatgacc
tga

DBGET integrated database retrieval system