KEGG   Homo sapiens (human): 143689Help
Entry
143689            CDS       T01001                                 

Gene name
PIWIL4, HIWI2, MIWI2
Definition
(RefSeq) piwi like RNA-mediated gene silencing 4
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    143689 (PIWIL4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    143689 (PIWIL4)
   piRNA pathway
    143689 (PIWIL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi PAZ ArgoN ArgoL1
Motif
Other DBs
NCBI-GeneID: 143689
NCBI-ProteinID: NP_689644
OMIM: 610315
HGNC: 18444
Ensembl: ENSG00000134627
Vega: OTTHUMG00000167811
Pharos: Q7Z3Z4(Tbio)
UniProt: Q7Z3Z4 A0A140VKG8
Position
11q21
AA seq 852 aa AA seqDB search
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagagcccgagtgaaggccagaggcatcgcccgcagccccagtgccacagaa
gtggggcgcatccaagcctcgccattgcctagatctgttgatcttagtaacaatgaagca
tcctctagcaatggcttcttgggaacaagcaggatctcaaccaacgataaatatgggata
tcttctggtgatgctggaagtaccttcatggaaagaggtgtgaaaaacaaacaggacttt
atggatttgagtatctgtaccagagaaaaattggcacatgtgagaaattgtaaaacaggt
tccagtggaatacctgtgaaactggttacaaacctctttaacttagattttccccaagac
tggcagctataccagtaccatgtgacatatattccagatttagcatctagaaggctgaga
attgctttactttatagtcatagtgaactttccaacaaagcaaaagcattcgacggtgcc
atcctttttctgtcacaaaagctagaagaaaaggtcacagagttgtcaagtgaaactcaa
agaggtgagactataaagatgactatcaccctgaagagggagctgccatcaagttctccc
gtgtgcatccaggtcttcaatatcatcttcagaaagatcctcaaaaagttgtccatgtac
caaattggacggaacttctataatccttcagagccaatggaaattccccagcacaaatta
tccctttggcctgggtttgccatttctgtgtcatattttgaaaggaagctcctgtttagt
gctgatgtgagttacaaagtcctccggaatgagacggttctggaattcatgactgctctc
tgtcaaagaactggcttgtcctgtttcacccagacgtgtgagaagcagctaatagggctc
attgtccttacaagatacaataacagaacctactccattgatgacattgactggtcagtg
aagcccacacacacctttcagaagcgggatggcaccgagatcacctatgtggattactac
aagcagcagtatgatattactgtatcggacctgaatcagcccatgcttgttagtctgtta
aagaagaagagaaatgacaacagtgaggctcagctcgcccacctgatacctgagctctgc
tttctaacagggctgactgaccaggcaacatctgatttccagctgatgaaggctgtggct
gaaaagacacgtctcagtccttcaggccggcagcagcgcctggccaggcttgtggacaac
atccagaggaataccaatgctcgctttgaactagagacctggggactgcattttggaagc
cagatatctctgactggccggattgtgccttcagaaaaaatattaatgcaagaccacata
tgtcaacctgtgtctgctgctgactggtccaaggatattcgaacttgcaagattttaaat
gcacagtctttgaatacctggttgattttatgtagcgacagaactgaatatgttgccgag
agctttctgaactgcttgagaagagttgcaggttccatgggatttaatgtggactacccc
aaaatcataaaagtacaagaaaatccagctgcatttgttagagctatacagcaatatgtt
gatcctgatgttcagctggtaatgtgcattctgccttctaatcagaagacctattatgat
tccattaaaaaatatttgagctcagactgcccagtcccaagccaatgtgtgcttgctcgg
accttgaataaacagggcatgatgatgagtatcgccaccaagatcgctatgcagatgact
tgcaagctcggaggcgagctgtgggctgtggaaatacctttaaagtccctgatggtggtc
ggtattgatgtctgtaaagatgcactcagcaaggacgtgatggttgttggatgcgtggcc
agtgttaaccccagaatcaccaggtggttttcccgctgtatccttcagagaacaatgact
gatgttgcagattgcttgaaagttttcatgactggagcactcaacaaatggtacaagtac
aatcatgatttgccagcacggataattgtgtaccgtgctggtgtaggggatggtcagctg
aaaacacttattgaatatgaagtcccacagctgctgagcagtgtggcagaatccagctca
aataccagctcaagactgtcggtgattgtggtcaggaagaagtgcatgccacgattcttt
accgaaatgaaccgcactgtacagaaccccccacttggcactgttgtggattcagaagca
acacgtaacgaatggtatgacttttatctgatcagccaggtggcctgccggggaactgtt
agtcctacctactataatgtcatctatgatgacaacggcttgaagcccgaccatatgcag
agacttacattcaaattgtgccacctgtactacaactggccgggcatagtcagtgtccca
gcaccatgtcagtatgctcacaagctgacctttctggtggcacaaagcattcataaagaa
cccagtctggaattagccaaccatctcttctacctgtga

DBGET integrated database retrieval system