KEGG   Homo sapiens (human): 143689
Entry
143689            CDS       T01001                                 

Symbol
PIWIL4, HIWI2, MIWI2
Name
(RefSeq) piwi like RNA-mediated gene silencing 4
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    143689 (PIWIL4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    143689 (PIWIL4)
   piRNA pathway
    143689 (PIWIL4)
SSDB
Motif
Pfam: Piwi PAZ ArgoN ArgoL1
Other DBs
NCBI-GeneID: 143689
NCBI-ProteinID: NP_689644
OMIM: 610315
HGNC: 18444
Ensembl: ENSG00000134627
Vega: OTTHUMG00000167811
Pharos: Q7Z3Z4(Tbio)
UniProt: Q7Z3Z4 A0A140VKG8
Position
11q21
AA seq 852 aa
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgagtggaagagcccgagtgaaggccagaggcatcgcccgcagccccagtgccacagaa
gtggggcgcatccaagcctcgccattgcctagatctgttgatcttagtaacaatgaagca
tcctctagcaatggcttcttgggaacaagcaggatctcaaccaacgataaatatgggata
tcttctggtgatgctggaagtaccttcatggaaagaggtgtgaaaaacaaacaggacttt
atggatttgagtatctgtaccagagaaaaattggcacatgtgagaaattgtaaaacaggt
tccagtggaatacctgtgaaactggttacaaacctctttaacttagattttccccaagac
tggcagctataccagtaccatgtgacatatattccagatttagcatctagaaggctgaga
attgctttactttatagtcatagtgaactttccaacaaagcaaaagcattcgacggtgcc
atcctttttctgtcacaaaagctagaagaaaaggtcacagagttgtcaagtgaaactcaa
agaggtgagactataaagatgactatcaccctgaagagggagctgccatcaagttctccc
gtgtgcatccaggtcttcaatatcatcttcagaaagatcctcaaaaagttgtccatgtac
caaattggacggaacttctataatccttcagagccaatggaaattccccagcacaaatta
tccctttggcctgggtttgccatttctgtgtcatattttgaaaggaagctcctgtttagt
gctgatgtgagttacaaagtcctccggaatgagacggttctggaattcatgactgctctc
tgtcaaagaactggcttgtcctgtttcacccagacgtgtgagaagcagctaatagggctc
attgtccttacaagatacaataacagaacctactccattgatgacattgactggtcagtg
aagcccacacacacctttcagaagcgggatggcaccgagatcacctatgtggattactac
aagcagcagtatgatattactgtatcggacctgaatcagcccatgcttgttagtctgtta
aagaagaagagaaatgacaacagtgaggctcagctcgcccacctgatacctgagctctgc
tttctaacagggctgactgaccaggcaacatctgatttccagctgatgaaggctgtggct
gaaaagacacgtctcagtccttcaggccggcagcagcgcctggccaggcttgtggacaac
atccagaggaataccaatgctcgctttgaactagagacctggggactgcattttggaagc
cagatatctctgactggccggattgtgccttcagaaaaaatattaatgcaagaccacata
tgtcaacctgtgtctgctgctgactggtccaaggatattcgaacttgcaagattttaaat
gcacagtctttgaatacctggttgattttatgtagcgacagaactgaatatgttgccgag
agctttctgaactgcttgagaagagttgcaggttccatgggatttaatgtggactacccc
aaaatcataaaagtacaagaaaatccagctgcatttgttagagctatacagcaatatgtt
gatcctgatgttcagctggtaatgtgcattctgccttctaatcagaagacctattatgat
tccattaaaaaatatttgagctcagactgcccagtcccaagccaatgtgtgcttgctcgg
accttgaataaacagggcatgatgatgagtatcgccaccaagatcgctatgcagatgact
tgcaagctcggaggcgagctgtgggctgtggaaatacctttaaagtccctgatggtggtc
ggtattgatgtctgtaaagatgcactcagcaaggacgtgatggttgttggatgcgtggcc
agtgttaaccccagaatcaccaggtggttttcccgctgtatccttcagagaacaatgact
gatgttgcagattgcttgaaagttttcatgactggagcactcaacaaatggtacaagtac
aatcatgatttgccagcacggataattgtgtaccgtgctggtgtaggggatggtcagctg
aaaacacttattgaatatgaagtcccacagctgctgagcagtgtggcagaatccagctca
aataccagctcaagactgtcggtgattgtggtcaggaagaagtgcatgccacgattcttt
accgaaatgaaccgcactgtacagaaccccccacttggcactgttgtggattcagaagca
acacgtaacgaatggtatgacttttatctgatcagccaggtggcctgccggggaactgtt
agtcctacctactataatgtcatctatgatgacaacggcttgaagcccgaccatatgcag
agacttacattcaaattgtgccacctgtactacaactggccgggcatagtcagtgtccca
gcaccatgtcagtatgctcacaagctgacctttctggtggcacaaagcattcataaagaa
cccagtctggaattagccaaccatctcttctacctgtga

KEGG   Homo sapiens (human): 440822
Entry
440822            CDS       T01001                                 

Symbol
PIWIL3, HIWI3
Name
(RefSeq) piwi like RNA-mediated gene silencing 3
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    440822 (PIWIL3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    440822 (PIWIL3)
   piRNA pathway
    440822 (PIWIL3)
SSDB
Motif
Pfam: Piwi PAZ ArgoN ArgoL1 ArgoL2 DDE_Tnp_1_6
Other DBs
NCBI-GeneID: 440822
NCBI-ProteinID: NP_001008496
OMIM: 610314
HGNC: 18443
Ensembl: ENSG00000184571
Vega: OTTHUMG00000150788
Pharos: Q7Z3Z3(Tdark)
UniProt: Q7Z3Z3
Position
22q11.23
AA seq 882 aa
MPGRARTRARGRARRRESYQQEAPGGPRAPGSATTQEPPQLQSTPRPLQEEVPVVRPLQP
RAARGGAGGGAQSQGVKEPGPEAGLHTAPLQERRIGGVFQDLVVNTRQDMKHVKDSKTGS
EGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRKFGERHIFDGNS
LLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPTSPDCLRYYNILFRRTFKLLDFEQ
VGRNYYTKKKAIQLYRHGTSLEIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKR
TSAQAQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDY
YRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCHMTGLTDEICKDYSIVKE
LAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQG
RRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITM
KPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCT
KCPIPSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIV
NRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVI
VYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFTLAFIVVKKRINTRFFLKHGSNFQNP
PPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCHMY
YNLPGIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgcctggtagggcaaggactcgcgcccgaggcagagcccgccgcagggagagctaccaa
caagaggcacctgggggacccagagcacctggatcagctacaacccaggagccccctcag
ttgcagtcgacaccccggccgctgcaggaggaagtcccagtggttagacctctgcagcca
agagcagcaagaggaggagcaggaggaggagcacagtctcaaggggtgaaggaacctgga
cctgaggctgggttgcatacagcgcccttgcaggagagaaggattggtggagtttttcaa
gacctggtggtgaacaccaggcaagatatgaagcatgttaaagactcaaaaacaggttca
gagggtacagtggtacagctactcgccaaccacttccgagtgatatctcgtcctcagtgg
gttgcatataaatacaacgttgactacaaaccagacatagaagatggaaatctccgtaca
attttacttgatcaacatagaaggaaatttggagagcgccatatatttgatggaaactct
ttattattatctcggccactaaaagagcggagagtggaatggttgagcacaaccaaagac
aaaaacatcgtgaagattacagttgagttttccaaagaactcacgcccacgtcgccagat
tgcctacgctattacaacattctctttagaagaactttcaagctgctggattttgaacaa
gttggtcgcaactattataccaaaaagaaggccattcagttataccgtcatggtaccagt
ttggaaatctggcttggttatgttacttctgttcttcaatacgaaaacagcattaccctc
tgtgccgatgtgagccacaaactgctccgaatagaaactgcttatgatttcataaagaga
acatctgcccaggcccagacaggaaacatccgagaggaagtaactaataaattaattgga
tcaattgttctgacaaaatacaacaacaaaacctacagagtagatgatattgattggaag
cagaatcctgaagacacatttaacaaatcagatggcagcaaaatcacctatatagactac
tacaggcagcaacataaagaaattgtcacagtgaagaaacagccacttttggtcagccag
ggcagatggaaaaagggcctaacgggtacacaacgtgaacctatcctgctgattcctcag
ctgtgccacatgacaggtctaacagatgaaatatgtaaagattatagcattgtgaaagaa
ttggctaaacatacaagattgagtccaagaagaaggcatcatacattaaaagaattcatc
aatactctacaagataataaaaaagtacgagagttacttcaactctgggatttgaaattt
gataccaattttttgtccgtcccgggaagagttttgaaaaacgcaaacatcgtgcaaggc
agaagaatggttaaagccaattcacaaggagactggtcaagagaaataagagaattaccc
ttacttaatgcaatgccactacatagttggctcatactctatagcaggagcagtcacaga
gaagccatgtccttaaagggtcatctacagagtgtcacagcccccatgggcataactatg
aaaccagcagaaatgattgaagtagatggtgatgctaactcctatatagacacattacgg
aaatatactagaccaacactgcagatgggaatgtcatgtttgctggttttcaaggtgatt
tgtatcctgcccaatgatgacaaacgtagatatgacagcataaaaagatacctatgtacc
aaatgcccaattccaagccagtgtgtggtgaaaaagaccttagaaaaagtccaggcaagg
accatcgtcaccaagattgcccagcagatgaattgcaagatgggaggagccctctggaag
gtggagacagacgtacaaagaacaatgttcgttggcattgattgtttccacgatatcgta
aatcgacagaaatcaatagcaggatttgttgcaagtaccaatgctgaattaacaaagtgg
tactctcaatgtgtcatccagaaaacaggagaagagcttgtgaaagagctggagatctgc
ttgaaagctgccctggatgtctggtgtaaaaacgaatcatcgatgccacattctgttatt
gtgtatcgggatggagtgggagatggtcagcttcaagcattgcttgaccatgaagcgaaa
aagatgtcgacctacttaaaaaccatctctcctaacaatttcactctagctttcattgtg
gtgaagaaacgaataaacactagattttttcttaaacatggaagcaattttcaaaatcca
cctccaggaacagttattgatgtagagttgactaggaatgaatggtatgacttttttatt
gtgagtcagtctgtgcaagatgggactgttacccccactcattataacgtcatctatgac
acgattggcttgagcccagatacagtacagcgtttaacatattgtctatgccacatgtat
tataatttgccaggcatcatccgagttccagcgccttgccactatgcccacaagctggct
tacctcgtggggcagtccattcaccaggaaccgaatcgttccttgtcaactcgtctcttt
tacctttga

KEGG   Homo sapiens (human): 55124
Entry
55124             CDS       T01001                                 

Symbol
PIWIL2, CT80, HILI, PIWIL1L, mili
Name
(RefSeq) piwi like RNA-mediated gene silencing 2
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55124 (PIWIL2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    55124 (PIWIL2)
   piRNA pathway
    55124 (PIWIL2)
SSDB
Motif
Pfam: Piwi PAZ ArgoL1
Other DBs
NCBI-GeneID: 55124
NCBI-ProteinID: NP_001129193
OMIM: 610312
HGNC: 17644
Ensembl: ENSG00000197181
Vega: OTTHUMG00000097767
Pharos: Q8TC59(Tbio)
UniProt: Q8TC59 W0HK13
Structure
PDB: 
3QIR 3O7X

Position
8p21.3
AA seq 973 aa
MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQ
RGPAQRESVGLVSMFRGLGIETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTF
WDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRG
PPQLSSPPALPQSPLHSPDRPLVLTVEHKEKELIVKQGSKGTPQSLGLNLVKIQCHNEAV
YQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSA
EISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIW
PGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVIT
RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ
DNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIA
KNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILT
IPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTL
GAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQ
INCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMP
HQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAF
ENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGC
GIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHH
EPAIQLCENLFFL
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggatcctttccgaccatcgttcaggggccagtctcctatccacccatcccagtgccag
gctgtacggatgccaggctgttggccacaagcttctaaacctttggacccagctctgggc
aggggagcacctgcaggcagaggccatgtatttggaaagccagaggaaccaagcacacag
agggggccagcacaaagggagtctgtgggtttggtctccatgttccgaggcctgggcatt
gaaacagtttctaagacccctctgaaacgggaaatgcttccatcaggtagaggcatttta
ggtcgaggcttgtctgctaatctggtacgcaaggacagggaggaactctctcccactttt
tgggatccaaaagtgttggcggctggggacagcaagatggcagagacctccgttggttgg
agtaggacgcttggaagagggagttcagatgcgtctttattaccactgggaagagcagca
ggtggtatcagcagagaagtggacaagcctccctgtaccttcagcacaccgtcccggggt
cccccgcagctgtcatcaccaccagctctgccccagtctcccctgcactctccagatcgc
cctctggtcctgactgtggaacacaaggaaaaagagcttattgtgaagcaaggatcaaaa
ggaacacctcagtctttgggactgaacctcgtcaaaatacagtgtcataatgaagcagtt
tatcaatatcatgtgactttcagccccaatgtggagtgcaaaagcatgaggttcggcatg
ttgaaggaccatcaagctgtcaccggcaacgtcactgcgtttgatggatctattctctat
ctgcctgttaagcttcaacaagttcttgagttaaaaagtcaaaggaaaacagacagtgct
gaaatcagcattaagattcagatgacaaagatcctggagccctgctctgacctgtgcatt
cccttctacaatgttgttttccgtcgggtaatgaaacttttagatatgaagcttgtgggg
agaaacttttatgaccctacaagtgctatggtactacagcaacacagattgcagatctgg
ccaggctatgcagctagcatccgaaggacagatggagggctcttcctgctagctgatgtc
tcccataaggtcattcggaatgactgtgtgctggatgtcatgcatgccatttatcagcag
aataaagaacacttccaggatgagtgtactaagcttctggttggcaatattgttatcacc
cgatataacaatcgtacctatcgtattgatgatgtggattggaataagactccaaaggat
agcttcacgatgtctgatgggaaagagatcacattcttggaatactacagcaaaaattat
gggatcacagttaaggaagaggaccagccattgctgattcacaggcccagtgagagacag
gataatcatgggatgctgctaaaaggggaaatcctgctgctgcctgagctttcttttatg
accggaatcccagagaagatgaagaaggacttcagagccatgaaggatttggctcagcaa
atcaatctgagccccaagcaacaccatagtgctttggaatgcttgctgcaaagaattgca
aagaacgaggcagccaccaatgaactgatgcgttgggggctccgtctgcaaaaggatgta
cataagattgaaggacgtgttctgccaatggaaagaattaacttaaaaaatacttcgttt
atcacatctcaggaactaaactgggttaaggaagtaaccagagacccttccatcttgact
atccccatgcatttctgggcacttttttacccaaagagagcaatggaccaggctcgagaa
ctggtcaacatgttggagaagatagccggccccattggcatgcgtatgagcccaccggcc
tgggttgaactaaaggatgaccgaatagagacttatgtcagaaccattcaatccacgtta
ggagctgaggggaagatacagatggttgtttgcatcatcatgggcccacgtgatgatctc
tatggggccatcaagaagctgtgctgtgtgcagtccccagtgccctcccaggttgtcaat
gttcgaaccattggtcagcccaccaggcttcggagtgtggcccagaagattttacttcag
attaactgtaaattgggtggtgagctctggggagtggatattcctctgaaacagttaatg
gtgatcgggatggatgtttaccatgaccccagtagaggcatgcgctccgtggttggcttc
gtggcaagcatcaatctcaccctcacaaaatggtattcccgggtggtgttccagatgccg
catcaggagattgtggacagcctgaagctatgcctcgtgggctccttaaaaaagttttat
gaggtgaaccactgtctaccagagaagattgtggtgtaccgtgatggagtgtctgatggc
caactgaagacagttgccaactatgagattcctcaactacagaagtgttttgaagctttt
gagaattatcagcccaagatggtggtgtttgtagttcagaagaaaatcagtactaatcta
tatctggctgctcctcagaactttgtaactcccactcctggaactgtggtagatcataca
ataacaagctgtgagtgggtggatttctatcttcttgcccatcatgtacggcagggctgt
ggcattcctacgcattatgtctgtgttctcaacaccgcaaacctgagccctgatcatatg
cagaggctgactttcaaactgtgccacatgtactggaattggcctggcaccatcagagtt
ccagctccttgcaagtatgcccacaagctagctttcctgtcaggacacatcttgcatcat
gaaccagccatccagctgtgcgagaacctgttcttcctgtga

KEGG   Homo sapiens (human): 9271
Entry
9271              CDS       T01001                                 

Symbol
PIWIL1, CT80.1, HIWI, MIWI, PIWI
Name
(RefSeq) piwi like RNA-mediated gene silencing 1
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9271 (PIWIL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    9271 (PIWIL1)
   piRNA pathway
    9271 (PIWIL1)
SSDB
Motif
Pfam: Piwi PAZ GAGE ArgoN ArgoL1
Other DBs
NCBI-GeneID: 9271
NCBI-ProteinID: NP_004755
OMIM: 605571
HGNC: 9007
Ensembl: ENSG00000125207
Vega: OTTHUMG00000168382
Pharos: Q96J94(Tbio)
UniProt: Q96J94 A0A024RBS5
Structure
PDB: 
3O7V 3O3I 3O6E 2L5C 2L5D

Position
12q24.33
AA seq 861 aa
MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
LVGQSIHREPNLSLSNRLYYL
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgactgggagagcccgagccagagccagaggaagggcccgcggtcaggagacagcgcag
ctggtgggctccactgccagtcagcaacctggttatattcagcctaggcctcagccgcca
ccagcagagggggaattatttggccgtggacggcagagaggaacagcaggaggaacagcc
aagtcacaaggactccagatatctgctggatttcaggagttatcgttagcagagagagga
ggtcgtcgtagagattttcatgatcttggtgtgaatacaaggcagaacctagaccatgtt
aaagaatcaaaaacaggttcttcaggcattatagtaaggttaagcactaaccatttccgg
ctgacatcccgtccccagtgggccttatatcagtatcacattgactataacccactgatg
gaagccagaagactccgttcagctcttctttttcaacacgaagatctaattggaaagtgt
catgcttttgatggaacgatattatttttacctaaaagactacagcaaaaggttactgaa
gtttttagtaagacccggaatggagaggatgtgaggataacgatcactttaacaaatgaa
cttccacctacatcaccaacttgtttgcagttctataatattattttcaggaggcttttg
aaaatcatgaatttgcaacaaattggacgaaattattataacccaaatgacccaattgat
attccaagtcacaggttggtgatttggcctggcttcactacttccatccttcagtatgaa
aacagcatcatgctctgcactgacgttagccataaagtccttcgaagtgagactgttttg
gatttcatgttcaacttttatcatcagacagaagaacataaatttcaagaacaagtttcc
aaagaactaataggtttagttgttcttaccaagtataacaataagacatacagagtggat
gatattgactgggaccagaatcccaagagcacctttaagaaagccgacggctctgaagtc
agcttcttagaatactacaggaagcaatacaaccaagagatcaccgacttgaagcagcct
gtcttggtcagccagcccaagagaaggcggggccctggggggacactgccagggcctgcc
atgctcattcctgagctctgctatcttacaggtctaactgataaaatgcgtaatgatttt
aacgtgatgaaagacttagccgttcatacaagactaactccagagcaaaggcagcgtgaa
gtgggacgactcattgattacattcataaaaacgataatgttcaaagggagcttcgagac
tggggtttgagctttgattccaacttactgtccttctcaggaagaattttgcaaacagaa
aagattcaccaaggtggaaaaacatttgattacaatccacaatttgcagattggtccaaa
gaaacaagaggtgcaccattaattagtgttaagccactagataactggctgttgatctat
acgcgaagaaattatgaagcagccaattcattgatacaaaatctatttaaagttacacca
gccatgggcatgcaaatgagaaaagcaataatgattgaagtggatgacagaactgaagcc
tacttaagagtcttacagcaaaaggtcacagcagacacccagatagttgtctgtctgttg
tcaagtaatcggaaggacaaatacgatgctattaaaaaatacctgtgtacagattgccct
accccaagtcagtgtgtggtggcccgaaccttaggcaaacagcaaactgtcatggccatt
gctacaaagattgccctacagatgaactgcaagatgggaggagagctctggagggtggac
atccccctgaagctcgtgatgatcgttggcatcgattgttaccatgacatgacagctggg
cggaggtcaatcgcaggatttgttgccagcatcaatgaagggatgacccgctggttctca
cgctgcatatttcaggatagaggacaggagctggtagatgggctcaaagtctgcctgcaa
gcggctctgagggcttggaatagctgcaatgagtacatgcccagccggatcatcgtgtac
cgcgatggcgtaggagacggccagctgaaaacactggtgaactacgaagtgccacagttt
ttggattgtctaaaatccattggtagaggttacaaccctagactaacggtaattgtggtg
aagaaaagagtgaacaccagattttttgctcagtctggaggaagacttcagaatccactt
cctggaacagttattgatgtagaggttaccagaccagaatggtatgacttttttatcgtg
agccaggctgtgagaagtggtagtgtttctcccacacattacaatgtcatctatgacaac
agcggcctgaagccagaccacatacagcgcttgacctacaagctgtgccacatctattac
aactggccaggtgtcattcgtgttcctgctccttgccagtacgcccacaagctggctttt
cttgttggccagagtattcacagagagccaaatctgtcactgtcaaaccgcctttactac
ctctaa

DBGET integrated database retrieval system