KEGG   Homo sapiens (human): 1437Help
Entry
1437              CDS       T01001                                 

Gene name
CSF2, CSF, GMCSF
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
N00187  KSHV Kaposin B to p38 signaling pathway
Drug target
Gimsilumab: D11121
Lenzilumab: D11236
Otilimab: D11343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    1437 (CSF2)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    1437 (CSF2)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    1437 (CSF2)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    1437 (CSF2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    1437 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1437 (CSF2)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    1437 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1437 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1437 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   1437 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF
Motif
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Vega: OTTHUMG00000059637
Pharos: P04141(Tbio)
UniProt: P04141
Structure
PDB: 

Position
5q31.1
AA seq 144 aa AA seqDB search
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

DBGET integrated database retrieval system