KEGG   Homo sapiens (human): 1439Help
Entry
1439              CDS       T01001                                 

Gene name
CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5, betaGMR
Definition
(RefSeq) colony stimulating factor 2 receptor beta common subunit
  KO
K04738  cytokine receptor common subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01122  Congenital pulmonary alveolar proteinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1439 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1439 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1439 (CSF2RB)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1439 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1439 (CSF2RB)
   04090 CD molecules [BR:hsa04090]
    1439 (CSF2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1439 (CSF2RB)
CD molecules [BR:hsa04090]
 Proteins
  1439 (CSF2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind Tissue_fac Interfer-bind IL2RB_N1 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 1439
NCBI-ProteinID: NP_000386
OMIM: 138981
HGNC: 2436
Ensembl: ENSG00000100368
Vega: OTTHUMG00000150546
Pharos: P32927(Tclin)
UniProt: P32927 Q6NSJ8
Structure
PDB: 

Position
22q12.3
AA seq 897 aa AA seqDB search
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggcccaggggctgctctccatggccctgctggccctgtgctgggagcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggacctcctggagccagtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgacgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgacccagcatgtccagcctcctgagcccagggacctgcag
atcagcaccgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccactggttgtccccaggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggacgcagccatcctcctctccaacacctcccaggccaccctggggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggttct
cggctctcaggacgtcccagcaagtggagcccagaggtttgctgggactcccagccaggg
gatgaggcccagccccagaacctggagtgcttctttgacggggccgccgtgctcagctgc
tcctgggaggtgaggaaggaggtggccagctcggtctcctttggcctattctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccgcgacccacggccaatacatc
gtctctgttcagccaaggagggcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcgatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgcgctcctgggacaccgagtcggtgctg
cctatgtgggtgctggccctcatcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaacgggagcgcagagctttggcccccaggcagcatg
tcggccttcactagcgggagtcccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccatagag
gaccccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctacccacagagcagccccccagcccccagccaggcccgcctgccgcctcccacacacct
gagaaacaggcttccagctttgacttcaatgggccctacctggggccgccccacagccgc
tccctacctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccaggacaggccgtggaagtggagagaaggccgagccag
ggggctgcagggagtccctccctggagtccgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccatgagctctggg
gacactgaggaccctggagtggcctctggttatgtctcctctgcagacctggtattcacc
ccaaactcaggggcctcgtctgtctccctagttccctctctgggcctcccctcagaccag
acccccagcttatgtcctgggctggccagtggaccccctggagccccaggccctgtgaag
tcagggtttgagggctatgtggagctccctccaattgagggccggtcccccaggtcacca
aggaacaatcctgtcccccctgaggccaaaagccctgtcctgaacccaggggaacgcccg
gcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaagtgggc
gactattgcttcctccccggcctggggcccggccctctctcgctccggagtaaaccttct
tccccgggacccggtcctgagatcaagaacctagaccaggcttttcaagtcaagaagccc
ccaggccaggctgtgccccaggtgcccgtcattcagctcttcaaagccctgaagcagcag
gactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

DBGET integrated database retrieval system