KEGG   Homo sapiens (human): 1439Help
Entry
1439              CDS       T01001                                 

Gene name
CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5, betaGMR
Definition
(RefSeq) colony stimulating factor 2 receptor beta common subunit
  KO
K04738  cytokine receptor common subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01122  Congenital pulmonary alveolar proteinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1439 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1439 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1439 (CSF2RB)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    1439 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1439 (CSF2RB)
   04090 CD Molecules [BR:hsa04090]
    1439 (CSF2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1439 (CSF2RB)
CD molecules [BR:hsa04090]
 Proteins
  1439 (CSF2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind Tissue_fac Interfer-bind Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 1439
NCBI-ProteinID: NP_000386
OMIM: 138981
HGNC: 2436
Ensembl: ENSG00000100368
Vega: OTTHUMG00000150546
Pharos: P32927(Tclin)
UniProt: P32927 Q6NSJ8
Structure
PDB: 

Position
22q12.3
AA seq 897 aa AA seqDB search
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggcccaggggctgctctccatggccctgctggccctgtgctgggagcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggacctcctggagccagtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgacgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgacccagcatgtccagcctcctgagcccagggacctgcag
atcagcaccgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccactggttgtccccaggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggacgcagccatcctcctctccaacacctcccaggccaccctggggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggttct
cggctctcaggacgtcccagcaagtggagcccagaggtttgctgggactcccagccaggg
gatgaggcccagccccagaacctggagtgcttctttgacggggccgccgtgctcagctgc
tcctgggaggtgaggaaggaggtggccagctcggtctcctttggcctattctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccgcgacccacggccaatacatc
gtctctgttcagccaaggagggcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcgatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgcgctcctgggacaccgagtcggtgctg
cctatgtgggtgctggccctcatcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaacgggagcgcagagctttggcccccaggcagcatg
tcggccttcactagcgggagtcccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccatagag
gaccccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctacccacagagcagccccccagcccccagccaggcccgcctgccgcctcccacacacct
gagaaacaggcttccagctttgacttcaatgggccctacctggggccgccccacagccgc
tccctacctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccaggacaggccgtggaagtggagagaaggccgagccag
ggggctgcagggagtccctccctggagtccgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccatgagctctggg
gacactgaggaccctggagtggcctctggttatgtctcctctgcagacctggtattcacc
ccaaactcaggggcctcgtctgtctccctagttccctctctgggcctcccctcagaccag
acccccagcttatgtcctgggctggccagtggaccccctggagccccaggccctgtgaag
tcagggtttgagggctatgtggagctccctccaattgagggccggtcccccaggtcacca
aggaacaatcctgtcccccctgaggccaaaagccctgtcctgaacccaggggaacgcccg
gcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaagtgggc
gactattgcttcctccccggcctggggcccggccctctctcgctccggagtaaaccttct
tccccgggacccggtcctgagatcaagaacctagaccaggcttttcaagtcaagaagccc
ccaggccaggctgtgccccaggtgcccgtcattcagctcttcaaagccctgaagcagcag
gactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

DBGET integrated database retrieval system