KEGG   Homo sapiens (human): 1439Help
Entry
1439              CDS       T01001                                 

Gene name
CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5, betaGMR
Definition
(RefSeq) colony stimulating factor 2 receptor beta common subunit
  KO
K04738  cytokine receptor common subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01122  Congenital pulmonary alveolar proteinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1439 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1439 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1439 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1439 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1439 (CSF2RB)
   04090 CD molecules [BR:hsa04090]
    1439 (CSF2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1439 (CSF2RB)
CD molecules [BR:hsa04090]
 Proteins
  1439 (CSF2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind Tissue_fac Interfer-bind IL2RB_N1 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 1439
NCBI-ProteinID: NP_000386
OMIM: 138981
HGNC: 2436
Ensembl: ENSG00000100368
Vega: OTTHUMG00000150546
Pharos: P32927(Tclin)
UniProt: P32927 Q6NSJ8
Structure
PDB: 

Position
22q12.3
AA seq 897 aa AA seqDB search
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggcccaggggctgctctccatggccctgctggccctgtgctgggagcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggacctcctggagccagtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgacgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgacccagcatgtccagcctcctgagcccagggacctgcag
atcagcaccgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccactggttgtccccaggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggacgcagccatcctcctctccaacacctcccaggccaccctggggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggttct
cggctctcaggacgtcccagcaagtggagcccagaggtttgctgggactcccagccaggg
gatgaggcccagccccagaacctggagtgcttctttgacggggccgccgtgctcagctgc
tcctgggaggtgaggaaggaggtggccagctcggtctcctttggcctattctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccgcgacccacggccaatacatc
gtctctgttcagccaaggagggcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcgatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgcgctcctgggacaccgagtcggtgctg
cctatgtgggtgctggccctcatcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaacgggagcgcagagctttggcccccaggcagcatg
tcggccttcactagcgggagtcccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccatagag
gaccccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctacccacagagcagccccccagcccccagccaggcccgcctgccgcctcccacacacct
gagaaacaggcttccagctttgacttcaatgggccctacctggggccgccccacagccgc
tccctacctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccaggacaggccgtggaagtggagagaaggccgagccag
ggggctgcagggagtccctccctggagtccgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccatgagctctggg
gacactgaggaccctggagtggcctctggttatgtctcctctgcagacctggtattcacc
ccaaactcaggggcctcgtctgtctccctagttccctctctgggcctcccctcagaccag
acccccagcttatgtcctgggctggccagtggaccccctggagccccaggccctgtgaag
tcagggtttgagggctatgtggagctccctccaattgagggccggtcccccaggtcacca
aggaacaatcctgtcccccctgaggccaaaagccctgtcctgaacccaggggaacgcccg
gcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaagtgggc
gactattgcttcctccccggcctggggcccggccctctctcgctccggagtaaaccttct
tccccgggacccggtcctgagatcaagaacctagaccaggcttttcaagtcaagaagccc
ccaggccaggctgtgccccaggtgcccgtcattcagctcttcaaagccctgaagcagcag
gactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

KEGG   Homo sapiens (human): 3563Help
Entry
3563              CDS       T01001                                 

Gene name
IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Daniplestim: D03645
Flotetuzumab: D11306
Leridistim: D04695
Milodistim: D05036
Muplestim: D05090
Tagraxofusp: D11358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3563 (IL3RA)
   04151 PI3K-Akt signaling pathway
    3563 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3563 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3563 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3563 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3563 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3563 (IL3RA)
   04090 CD molecules [BR:hsa04090]
    3563 (IL3RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3563 (IL3RA)
CD molecules [BR:hsa04090]
 Proteins
  3563 (IL3RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Tissue_fac DUF4812 Y_Y_Y
Motif
Other DBs
NCBI-GeneID: 3563
NCBI-ProteinID: NP_002174
OMIM: 308385 430000
HGNC: 6012
Ensembl: ENSG00000185291
Vega: OTTHUMG00000021059
Pharos: P26951(Tbio)
UniProt: P26951
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 378 aa AA seqDB search
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctttggctcacgctgctcctgatcgccctgccctgtctcctgcaaacgaag
gaagatccaaacccaccaatcacgaacctaaggatgaaagcaaaggctcagcagttgacc
tgggaccttaacagaaatgtgaccgatatcgagtgtgttaaagacgccgactattctatg
ccggcagtgaacaatagctattgccagtttggagcaatttccttatgtgaagtgaccaac
tacaccgtccgagtggccaacccaccattctccacgtggatcctcttccctgagaacagt
gggaagccttgggcaggtgcggagaatctgacctgctggattcatgacgtggatttcttg
agctgcagctgggcggtaggcccgggggcccccgcggacgtccagtacgacctgtacttg
aacgttgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcaggga
acacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagttcc
cacatcctggtgcggggcaggagcgcagccttcggtatcccctgcacagataagtttgtc
gtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataagaca
cattcctttatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatacaaaagagaatgcagcctgtaatcacagaacaggtcagagacagaacctccttc
cagctactcaatcctggaacgtacacagtacaaataagagcccgggaaagagtgtatgaa
ttcttgagcgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcaaac
acacgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccctggtctgt
gtcttcgtgatctgcagaaggtatctggtgatgcagagactctttccccgcatccctcac
atgaaagaccccatcggtgacagcttccaaaacgacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgactgaagtacaggtcgtgcagaaaacttga

DBGET integrated database retrieval system